StarFunc result for job id Q9UL15

User Input

>input (447 residues)
MDMGNQHPSISRLQEIQKEVKSVEQQVIGFSGLSDDKNYKKLERILTKQLFEIDSVDTEG
KGDIQQARKRAAQETERLLKELEQNANHPHRIEIQNIFEEAQSLVREKIVPFYNGGNCVT
DEFEEGIQDIILRLTHVKTGGKISLRKARYHTLTKICAVQEIIEDCMKKQPSLPLSEDAH
PSVAKINFVMCEVNKARGVLIALLMGVNNNETCRHLSCVLSGLIADLDALDVCGRTEIRN
YRREVVEDINKLLKYLDLEEEADTTKAFDLRQNHSILKIEKVLKRMREIKNELLQAQNPS
ELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKEALEKRKLFAC
EEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKC
KAARKQAVRLAQNILSYLDLKSDEWEY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5QJC9	0.990	0.990	2.857E-45	447	0.908	0.908	Q5QJC9.pdb.gz	BAG5_RAT BAG family molecular chaperone regulator 5 OS=Rattus norvegicus OX=10116 GN=Bag5 PE=1 SV=1
2	AFDB:Q5XIR5	0.186	0.182	1.920E-3	457	0.078	0.077	Q5XIR5.pdb.gz	Q5XIR5_RAT BAG cochaperone 4 OS=Rattus norvegicus OX=10116 GN=Bag4 PE=1 SV=1
3	AFDB:F1Q9J0	0.190	0.177	2.250E-3	480	0.078	0.073	F1Q9J0.pdb.gz
4	AFDB:Q9JLV1	0.187	0.145	2.744E-3	577	0.078	0.061	Q9JLV1.pdb.gz	BAG3_MOUSE BAG family molecular chaperone regulator 3 OS=Mus musculus OX=10090 GN=Bag3 PE=1 SV=2
5	AFDB:O95817	0.184	0.143	2.855E-3	575	0.078	0.061	O95817.pdb.gz	BAG3_HUMAN BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3
6	AFDB:O95429	0.188	0.184	3.091E-3	457	0.078	0.077	O95429.pdb.gz	BAG4_HUMAN BAG family molecular chaperone regulator 4 OS=Homo sapiens OX=9606 GN=BAG4 PE=1 SV=1
7	AFDB:M9PCD9	0.183	0.136	3.623E-3	610	0.063	0.046	M9PCD9.pdb.gz	M9PCD9_DROME Starvin, isoform F OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=1
8	AFDB:A8JNS4	0.183	0.130	6.069E-3	635	0.063	0.044	A8JNS4.pdb.gz	A8JNS4_DROME Starvin, isoform E OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=1
9	AFDB:Q9BLJ6	0.168	0.113	1.101E-2	677	0.056	0.037	Q9BLJ6.pdb.gz	BAGS_BOMMO BAG domain-containing protein Samui OS=Bombyx mori OX=7091 GN=Samui PE=2 SV=1
10	PDB:7l1kB	0.163	0.129	3.730E-1	660	0.148	0.100	7l1kB.pdb.gz	Molecular mechanism of N-terminal acetylation by the ternary NatC complex.
11	AFDB:G5EBM4	0.114	0.118	4.238E-1	424	0.123	0.130	G5EBM4.pdb.gz	G5EBM4_CAEEL Battenin OS=Caenorhabditis elegans OX=6239 GN=cln-3.1 PE=2 SV=1
12	PDB:6uqkA	0.125	0.050	5.124E-1	2054	0.154	0.034	6uqkA.pdb.gz	Cryo-EM structure of human type-3 inositol triphosphate receptor reveals the presence of a self-binding peptide that acts as an antagonist.
13	PDB:7usdA	0.143	0.071	5.772E-1	1185	0.125	0.047	7usdA.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
14	PDB:7vktA	0.095	0.133	8.249E-1	287	0.096	0.150	7vktA.pdb.gz	Structural basis of leukotriene B4 receptor 1 activation.
15	PDB:3zxpA	0.122	0.134	8.583E-1	394	0.092	0.104	3zxpA.pdb.gz
16	PDB:7pksb	0.155	0.083	1.047	1047	0.134	0.057	7pksb.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
17	PDB:5gm6G	0.128	0.088	1.089	875	0.150	0.077	5gm6G.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:7ploK	0.146	0.112	1.089	639	0.152	0.106	7ploK.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
19	PDB:7egb9	0.107	0.129	1.179	287	0.092	0.143	7egb9.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
20	PDB:7po24	0.153	0.127	1.328	592	0.110	0.083	7po24.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5QJC9	0.0	839	447	0.908	0.908	BAG5_RAT BAG family molecular chaperone regulator 5 OS=Rattus norvegicus OX=10116 GN=Bag5 PE=1 SV=1
2	Q8CI32	0.0	845	447	0.913	0.913	BAG5_MOUSE BAG family molecular chaperone regulator 5 OS=Mus musculus OX=10090 GN=Bag5 PE=1 SV=1
3	Q9UL15	0.0	911	447	1.000	1.000	BAG5_HUMAN BAG family molecular chaperone regulator 5 OS=Homo sapiens OX=9606 GN=BAG5 PE=1 SV=1
4	Q9JLV1	9.19e-13	72.4	577	0.087	0.068	BAG3_MOUSE BAG family molecular chaperone regulator 3 OS=Mus musculus OX=10090 GN=Bag3 PE=1 SV=2
5	O95817	2.74e-12	70.9	575	0.087	0.068	BAG3_HUMAN BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3
6	Q6DC38	4.14e-12	70.1	459	0.076	0.074	Q6DC38_DANRE BAG family molecular chaperone regulator 3 OS=Danio rerio OX=7955 GN=zgc:100859 PE=2 SV=1
7	A0A8I6AP78	2.52e-08	58.2	457	0.072	0.070	A0A8I6AP78_RAT BAG cochaperone 4 OS=Rattus norvegicus OX=10116 GN=Bag4 PE=1 SV=1
8	Q5XIR5	3.95e-08	57.8	457	0.072	0.070	Q5XIR5_RAT BAG cochaperone 4 OS=Rattus norvegicus OX=10116 GN=Bag4 PE=1 SV=1
9	O95429	5.52e-08	57.4	457	0.072	0.070	BAG4_HUMAN BAG family molecular chaperone regulator 4 OS=Homo sapiens OX=9606 GN=BAG4 PE=1 SV=1
10	Q8CI61	7.86e-08	56.6	457	0.072	0.070	BAG4_MOUSE BAG family molecular chaperone regulator 4 OS=Mus musculus OX=10090 GN=Bag4 PE=1 SV=2
11	Q9VU83	5.18e-07	54.3	516	0.058	0.050	Q9VU83_DROME Starvin, isoform B OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=1
12	Q9VU81	6.25e-07	54.3	609	0.058	0.043	Q9VU81_DROME GH02003p OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=2
13	M9PCD9	6.36e-07	53.9	610	0.058	0.043	M9PCD9_DROME Starvin, isoform F OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=1
14	Q9VU82	7.19e-07	53.9	542	0.058	0.048	Q9VU82_DROME Starvin, isoform C OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=1
15	A8JNS4	8.06e-07	53.9	635	0.058	0.041	A8JNS4_DROME Starvin, isoform E OS=Drosophila melanogaster OX=7227 GN=stv PE=1 SV=1
16	Q9BLJ6	8.44e-06	50.4	677	0.051	0.034	BAGS_BOMMO BAG domain-containing protein Samui OS=Bombyx mori OX=7091 GN=Samui PE=2 SV=1
17	O59739	0.087	36.6	206	0.040	0.087	BAG1B_SCHPO BAG family molecular chaperone regulator 1B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bag102 PE=1 SV=1
18	Q0WUQ1	0.23	36.2	342	0.065	0.085	BAG1_ARATH BAG family molecular chaperone regulator 1 OS=Arabidopsis thaliana OX=3702 GN=BAG1 PE=1 SV=1
19	Q55CT4	2.5	33.1	861	0.029	0.015	Q55CT4_DICDI Aminopeptidase OS=Dictyostelium discoideum OX=44689 GN=psaA PE=3 SV=1
20	P93083	2.8	32.7	498	0.081	0.072	TDC2_CAMAC Tryptophan decarboxylase TDC2 OS=Camptotheca acuminata OX=16922 GN=TDC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02179 BAG	5.6e-48	172.8	BAG domain
2	PF12867 DinB_2	2.4e+02	13.6	DinB superfamily
3	PF05373 Pro_3_hydrox_C	3.4e+02	12.8	L-proline 3-hydroxylase, C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003807065.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003831833.2	0.933	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 204 ESTs, 5 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
2	9597.XP_008955414.1	0.933	Heat shock 70 kDa protein 1
3	9597.XP_003829335.1	0.913	Heat shock 70 kDa protein 4 isoform X1
4	9597.XP_003831596.1	0.898	Belongs to the heat shock protein 70 family.
5	9597.XP_003831655.1	0.847	Heat shock-related 70 kDa protein 2
6	9597.XP_008950000.1	0.839	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 2 codons
7	9597.XP_008971636.1	0.839	Belongs to the heat shock protein 70 family.
8	9597.XP_003806806.1	0.829	Belongs to the heat shock protein 70 family.
9	9597.XP_003819237.1	0.829	Heat shock 70 kDa protein 13
10	9597.XP_008974938.1	0.809	Heat shock 70 kDa protein 4L
11	9597.XP_003821426.1	0.802	Heat shock protein family A (Hsp70) member 12B
12	9597.XP_003825672.2	0.801	Heat shock 70 kDa protein 12A isoform X1
13	9597.XP_003829266.1	0.776	Heat shock protein family A (Hsp70) member 9
14	9597.XP_003808092.1	0.774	Heat shock protein family A (Hsp70) member 5
15	9597.XP_008953736.1	0.772	BCL2 associated athanogene 1
16	9597.XP_008959176.1	0.761	STIP1 homology and U-box containing protein 1
17	9597.XP_003828970.1	0.758	BCL2 associated athanogene 2
18	9597.XP_003825774.1	0.757	Leucine-rich repeat serine/threonine-protein kinase 2
19	9597.XP_008950457.1	0.747	Heat shock protein family H (Hsp110) member 1
20	9597.XP_008971992.1	0.678	TNF receptor superfamily member 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031625	0.999	ubiquitin protein ligase binding
GO:0051087	0.998	chaperone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0009987	0.994	cellular process
GO:0050794	0.994	regulation of cellular process
GO:0051338	0.978	regulation of transferase activity
GO:0051128	0.977	regulation of cellular component organization
GO:0031396	0.977	regulation of protein ubiquitination
GO:0031400	0.976	negative regulation of protein modification process
GO:0031323	0.972	regulation of cellular metabolic process
GO:0031397	0.972	negative regulation of protein ubiquitination
GO:0048583	0.970	regulation of response to stimulus
GO:0051438	0.967	regulation of ubiquitin-protein transferase activity
GO:0065008	0.965	regulation of biological quality
GO:0010941	0.965	regulation of cell death
GO:0048523	0.961	negative regulation of cellular process
GO:0023051	0.956	regulation of signaling
GO:0010646	0.956	regulation of cell communication
GO:0044087	0.955	regulation of cellular component biogenesis
GO:0009966	0.953	regulation of signal transduction
GO:0031647	0.948	regulation of protein stability
GO:0042981	0.936	regulation of apoptotic process
GO:0009894	0.933	regulation of catabolic process
GO:0060548	0.933	negative regulation of cell death
GO:0080135	0.883	regulation of cellular response to stress
GO:0030162	0.871	regulation of proteolysis
GO:0071840	0.862	cellular component organization or biogenesis
GO:0043066	0.862	negative regulation of apoptotic process
GO:0016043	0.852	cellular component organization
GO:0048585	0.846	negative regulation of response to stimulus
GO:1902882	0.810	regulation of response to oxidative stress
GO:2001233	0.807	regulation of apoptotic signaling pathway
GO:0006457	0.768	protein folding
GO:0042176	0.761	regulation of protein catabolic process
GO:1902531	0.759	regulation of intracellular signal transduction
GO:1903201	0.748	regulation of oxidative stress-induced cell death
GO:0051129	0.726	negative regulation of cellular component organization
GO:1903050	0.720	regulation of proteolysis involved in protein catabolic process
GO:0050821	0.711	protein stabilization
GO:2001242	0.706	regulation of intrinsic apoptotic signaling pathway
GO:0006996	0.701	organelle organization
GO:0009968	0.684	negative regulation of signal transduction
GO:0061136	0.656	regulation of proteasomal protein catabolic process
GO:2001234	0.636	negative regulation of apoptotic signaling pathway
GO:1902532	0.630	negative regulation of intracellular signal transduction
GO:0031329	0.622	regulation of cellular catabolic process
GO:1903202	0.614	negative regulation of oxidative stress-induced cell death
GO:0031324	0.607	negative regulation of cellular metabolic process
GO:0045861	0.574	negative regulation of proteolysis
GO:2001243	0.568	negative regulation of intrinsic apoptotic signaling pathway
GO:0009895	0.546	negative regulation of catabolic process
GO:0031345	0.526	negative regulation of cell projection organization
GO:0042177	0.525	negative regulation of protein catabolic process
GO:0044092	0.515	negative regulation of molecular function
GO:1903051	0.501	negative regulation of proteolysis involved in protein catabolic process
GO:0032434	0.407	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0048518	0.396	positive regulation of biological process
GO:0050896	0.347	response to stimulus
GO:0008152	0.317	metabolic process
GO:0007030	0.317	Golgi organization
GO:0031330	0.310	negative regulation of cellular catabolic process
GO:1901799	0.305	negative regulation of proteasomal protein catabolic process
GO:0010977	0.304	negative regulation of neuron projection development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0032991	0.997	protein-containing complex
GO:0016020	0.975	membrane
GO:0005739	0.969	mitochondrion
GO:0005634	0.962	nucleus
GO:0070013	0.932	intracellular organelle lumen
GO:0048471	0.514	perinuclear region of cytoplasm
GO:0016234	0.486	inclusion body
GO:0012505	0.476	endomembrane system
GO:0005654	0.423	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]