StarFunc result for job id Q9UL17

User Input

>input (535 residues)
MGIVEPGCGDMLTGTEPMPGSDEGRAPGADPQHRYFYPEPGAQDADERRGGGSLGSPYPG
GALVPAPPSRFLGAYAYPPRPQAAGFPGAGESFPPPADAEGYQPGEGYAAPDPRAGLYPG
PREDYALPAGLEVSGKLRVALNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPT
SHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFG
KLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEPEAACNASNTHIFTFQETQFI
AVTAYQNAEITQLKIDNNPFAKGFRENFESMYTSVDTSIPSPPGPNCQFLGGDHYSPLLP
NQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYY
RGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEI
APIRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UL17	0.999	0.999	1.104E-91	535	1.000	1.000	Q9UL17.pdb.gz	TBX21_HUMAN T-box transcription factor TBX21 OS=Homo sapiens OX=9606 GN=TBX21 PE=1 SV=1
2	AFDB:Q9JKD8	0.521	0.525	1.128E-81	530	0.869	0.877	Q9JKD8.pdb.gz	TBX21_MOUSE T-box transcription factor TBX21 OS=Mus musculus OX=10090 GN=Tbx21 PE=1 SV=1
3	AFDB:P79944	0.369	0.287	1.568E-41	692	0.415	0.321	P79944.pdb.gz	EOMES_XENLA Eomesodermin OS=Xenopus laevis OX=8355 GN=eomes PE=2 SV=1
4	AFDB:O93288	0.339	0.335	1.256E-31	541	0.282	0.279	O93288.pdb.gz	O93288_CHICK T-Box protein 4 OS=Gallus gallus OX=9031 GN=TBX4 PE=1 SV=1
5	AFDB:Q8JFF9	0.342	0.330	3.324E-31	554	0.273	0.264	Q8JFF9.pdb.gz	Q8JFF9_DANRE T-box containing transcription factor OS=Danio rerio OX=7955 GN=tbx18 PE=2 SV=1
6	AFDB:P70323	0.354	0.395	9.931E-31	479	0.275	0.307	P70323.pdb.gz	TBX1_MOUSE T-box transcription factor TBX1 OS=Mus musculus OX=10090 GN=Tbx1 PE=1 SV=2
7	AFDB:B3DGX3	0.344	0.340	1.346E-30	543	0.252	0.249	B3DGX3.pdb.gz
8	AFDB:O43435	0.351	0.468	2.792E-30	398	0.250	0.337	O43435.pdb.gz	TBX1_HUMAN T-box transcription factor TBX1 OS=Homo sapiens OX=9606 GN=TBX1 PE=1 SV=1
9	AFDB:O70306	0.338	0.302	1.001E-29	602	0.273	0.243	O70306.pdb.gz	TBX15_MOUSE T-box transcription factor TBX15 OS=Mus musculus OX=10090 GN=Tbx15 PE=1 SV=2
10	AFDB:O62535	0.340	0.258	2.815E-29	712	0.249	0.187	O62535.pdb.gz	O62535_DROME Optomotor-blind-related gene-1 protein OS=Drosophila melanogaster OX=7227 GN=org-1 PE=2 SV=1
11	PDB:1ddtA	0.134	0.136	4.249E-2	523	0.034	0.034	1ddtA.pdb.gz	Refined structure of dimeric diphtheria toxin at 2.0 A resolution.
12	PDB:7bw8C	0.091	0.249	4.515E-2	138	0.045	0.174	7bw8C.pdb.gz
13	PDB:7ea3J	0.090	0.060	4.515E-2	883	0.015	0.009	7ea3J.pdb.gz
14	PDB:4ziqA	0.146	0.064	5.419E-2	1450	0.030	0.011	4ziqA.pdb.gz
15	PDB:4n6rB	0.164	0.354	5.759E-2	198	0.041	0.111	4n6rB.pdb.gz
16	PDB:2iqyA	0.086	0.191	6.504E-2	190	0.037	0.105	2iqyA.pdb.gz
17	PDB:7b0xC	0.122	0.254	7.345E-2	211	0.028	0.071	7b0xC.pdb.gz
18	PDB:7q1yA	0.117	0.053	9.367E-2	1374	0.017	0.007	7q1yA.pdb.gz
19	PDB:3t6qC	0.112	0.275	9.955E-2	139	0.043	0.165	3t6qC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
20	PDB:1l9mB	0.128	0.105	1.058E-1	681	0.045	0.035	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9JKD8	0.0	927	530	0.869	0.877	TBX21_MOUSE T-box transcription factor TBX21 OS=Mus musculus OX=10090 GN=Tbx21 PE=1 SV=1
2	Q9UL17	0.0	1092	535	1.000	1.000	TBX21_HUMAN T-box transcription factor TBX21 OS=Homo sapiens OX=9606 GN=TBX21 PE=1 SV=1
3	P79944	5.89e-104	328	692	0.415	0.321	EOMES_XENLA Eomesodermin OS=Xenopus laevis OX=8355 GN=eomes PE=2 SV=1
4	D4A6N8	2.69e-100	319	681	0.303	0.238	D4A6N8_RAT T-box brain transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Tbr1 PE=1 SV=4
5	Q64336	2.74e-100	319	681	0.303	0.238	TBR1_MOUSE T-box brain protein 1 OS=Mus musculus OX=10090 GN=Tbr1 PE=1 SV=2
6	Q16650	3.03e-100	319	682	0.303	0.238	TBR1_HUMAN T-box brain protein 1 OS=Homo sapiens OX=9606 GN=TBR1 PE=1 SV=1
7	Q98TU2	1.72e-98	313	661	0.383	0.310	Q98TU2_DANRE Eomesa protein OS=Danio rerio OX=7955 GN=eomes PE=2 SV=1
8	E8Z504	5.98e-98	312	650	0.370	0.305	E8Z504_SALSA Eomesodermin OS=Salmo salar OX=8030 GN=Eomes PE=2 SV=1
9	O54839	4.74e-97	311	707	0.370	0.280	EOMES_MOUSE Eomesodermin homolog OS=Mus musculus OX=10090 GN=Eomes PE=1 SV=3
10	O95936	4.34e-89	290	686	0.264	0.206	EOMES_HUMAN Eomesodermin homolog OS=Homo sapiens OX=9606 GN=EOMES PE=1 SV=3
11	E3W6T6	1.85e-59	204	422	0.196	0.249	E3W6T6_DANRE T-box 5b isoform X1 OS=Danio rerio OX=7955 GN=si:dkey-114c15.2 PE=2 SV=1
12	Q9IAK8	2.84e-59	206	492	0.200	0.217	TBX5A_DANRE T-box transcription factor TBX5-A OS=Danio rerio OX=7955 GN=tbx5a PE=2 SV=2
13	P57082	3.20e-59	207	545	0.196	0.193	TBX4_HUMAN T-box transcription factor TBX4 OS=Homo sapiens OX=9606 GN=TBX4 PE=1 SV=2
14	P70325	3.42e-59	207	552	0.196	0.190	TBX4_MOUSE T-box transcription factor TBX4 OS=Mus musculus OX=10090 GN=Tbx4 PE=1 SV=3
15	F1R688	3.59e-59	207	543	0.196	0.193	F1R688_DANRE T-box transcription factor 4 OS=Danio rerio OX=7955 GN=tbx4 PE=4 SV=1
16	O93288	6.81e-59	206	541	0.200	0.198	O93288_CHICK T-Box protein 4 OS=Gallus gallus OX=9031 GN=TBX4 PE=1 SV=1
17	Q99593	2.12e-58	204	518	0.200	0.207	TBX5_HUMAN T-box transcription factor TBX5 OS=Homo sapiens OX=9606 GN=TBX5 PE=1 SV=2
18	P70326	2.84e-58	204	518	0.200	0.207	TBX5_MOUSE T-box transcription factor TBX5 OS=Mus musculus OX=10090 GN=Tbx5 PE=1 SV=2
19	Q9PWE8	3.35e-58	204	521	0.200	0.205	TBX5_CHICK T-box transcription factor TBX5 OS=Gallus gallus OX=9031 GN=TBX5 PE=1 SV=1
20	Q5I2P1	1.44e-57	202	517	0.198	0.205	TBX5_RAT T-box transcription factor TBX5 OS=Rattus norvegicus OX=10116 GN=Tbx5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00907 T-box	2.9e-76	267.0	T-box
2	PF16176 T-box_assoc	4.7e+02	12.3	T-box transcription factor-associated

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000177694

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382800	0.993	Runt-related transcription factor 3
2	9606.ENSP00000384371	0.989	B-cell lymphoma 6 protein
3	9606.ENSP00000368632	0.988	Trans-acting T-cell-specific transcription factor GATA-3
4	9606.ENSP00000254846	0.971	Lysine-specific demethylase 6B
5	9606.ENSP00000300305	0.936	Runt-related transcription factor 1
6	9606.ENSP00000216341	0.901	Granzyme B
7	9606.ENSP00000011653	0.888	T-cell surface glycoprotein CD4
8	9606.ENSP00000365380	0.886	Forkhead box protein P3
9	9606.ENSP00000386559	0.881	T-cell surface glycoprotein CD8 alpha chain
10	9606.ENSP00000229135	0.871	Interferon gamma
11	9606.ENSP00000355870	0.871	H2.0-like homeobox protein
12	9606.ENSP00000344192	0.860	Interleukin-17A
13	9606.ENSP00000231449	0.848	Interleukin-4
14	9606.ENSP00000395654	0.847	Transcription activator BRG1
15	9606.ENSP00000327025	0.838	Nuclear receptor ROR-gamma
16	9606.ENSP00000362795	0.832	C-X-C chemokine receptor type 3
17	9606.ENSP00000226730	0.814	Interleukin-2
18	9606.ENSP00000412237	0.812	Interleukin-10
19	9606.ENSP00000398568	0.809	Perforin-1
20	9606.ENSP00000303939	0.791	Cytotoxic T-lymphocyte protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000976	0.993	transcription cis-regulatory region binding
GO:0001227	0.850	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0010468	0.995	regulation of gene expression
GO:0006355	0.991	regulation of DNA-templated transcription
GO:0009987	0.990	cellular process
GO:0050896	0.989	response to stimulus
GO:0048522	0.981	positive regulation of cellular process
GO:0010604	0.918	positive regulation of macromolecule metabolic process
GO:0031325	0.899	positive regulation of cellular metabolic process
GO:0048519	0.898	negative regulation of biological process
GO:0048523	0.894	negative regulation of cellular process
GO:0051173	0.891	positive regulation of nitrogen compound metabolic process
GO:0002376	0.884	immune system process
GO:0006357	0.875	regulation of transcription by RNA polymerase II
GO:0051716	0.855	cellular response to stimulus
GO:0031328	0.850	positive regulation of cellular biosynthetic process
GO:1903508	0.835	positive regulation of nucleic acid-templated transcription
GO:0010605	0.831	negative regulation of macromolecule metabolic process
GO:0045893	0.830	positive regulation of DNA-templated transcription
GO:0051172	0.787	negative regulation of nitrogen compound metabolic process
GO:0045892	0.728	negative regulation of DNA-templated transcription
GO:0032501	0.713	multicellular organismal process
GO:0048583	0.712	regulation of response to stimulus
GO:0048856	0.635	anatomical structure development
GO:0006955	0.567	immune response
GO:0051239	0.516	regulation of multicellular organismal process
GO:0002684	0.497	positive regulation of immune system process
GO:0009605	0.470	response to external stimulus
GO:0051240	0.463	positive regulation of multicellular organismal process
GO:0048584	0.463	positive regulation of response to stimulus
GO:0006950	0.445	response to stress
GO:0001817	0.434	regulation of cytokine production
GO:0048870	0.411	cell motility
GO:0042221	0.399	response to chemical
GO:0044419	0.366	biological process involved in interspecies interaction between organisms
GO:0007154	0.357	cell communication
GO:0016477	0.354	cell migration
GO:0002694	0.347	regulation of leukocyte activation
GO:0023052	0.345	signaling
GO:0001819	0.345	positive regulation of cytokine production
GO:0007165	0.342	signal transduction
GO:0007275	0.338	multicellular organism development
GO:0051707	0.331	response to other organism
GO:0000122	0.327	negative regulation of transcription by RNA polymerase II
GO:0006952	0.312	defense response
GO:0030154	0.307	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.684	cytoplasm
GO:0031974	0.673	membrane-enclosed lumen
GO:0016020	0.539	membrane
GO:0071944	0.527	cell periphery
GO:0005886	0.520	plasma membrane
GO:0043233	0.485	organelle lumen
GO:0070013	0.481	intracellular organelle lumen
GO:0031981	0.460	nuclear lumen
GO:0005654	0.437	nucleoplasm
GO:0043232	0.314	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]