StarFunc result for job id Q9UL18

User Input

>input (857 residues)
MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIK
PDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGE
GKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFF
SPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRN
IDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLESGQ
TVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTS
TMIKATARSAPDRQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGG
RNRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLKNFTDQLRKISKDAG
MPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGM
ATQCVQVKNVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVFQQPVIFLGADVTHPP
AGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFKPT
RIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKNE
RIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQIL
TYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKEHDSGEGSHISGQSNGRDPQAL
AKAVQVHQDTLRTMYFA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4krfA	0.939	0.984	0.000	817	0.940	0.987	4krfA.pdb.gz	The making of a slicer: activation of human argonaute-1.
2	PDB:4w5tA	0.922	0.979	0.000	807	0.786	0.835	4w5tA.pdb.gz	Gene regulation. Structural basis for microRNA targeting.
3	PDB:5vm9C	0.895	0.976	0.000	785	0.789	0.861	5vm9C.pdb.gz	Human Argonaute3 has slicer activity.
4	PDB:5weaA	0.858	0.960	0.000	764	0.741	0.831	5weaA.pdb.gz	Helix-7 in Argonaute2 shapes the microRNA seed region for rapid target recognition.
5	PDB:6oonA	0.909	0.992	0.000	785	0.776	0.847	6oonA.pdb.gz	Multidomain Convergence of Argonaute during RISC Assembly Correlates with the Formation of Internal Water Clusters.
6	AFDB:E7EXY4	0.969	0.952	0.000	873	0.816	0.801	E7EXY4.pdb.gz
7	AFDB:G5EES3	0.963	0.808	0.000	1023	0.681	0.571	G5EES3.pdb.gz	G5EES3_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-1 PE=1 SV=1
8	AFDB:O16720	0.963	0.907	0.000	910	0.662	0.623	O16720.pdb.gz	O16720_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-2 PE=1 SV=2
9	AFDB:Q32KD4	0.975	0.850	0.000	984	0.742	0.646	Q32KD4.pdb.gz	Q32KD4_DROME Argonaute-1, isoform A OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=1 SV=1
10	AFDB:Q8CJF8	0.976	0.971	0.000	861	0.826	0.822	Q8CJF8.pdb.gz	AGO4_MOUSE Protein argonaute-4 OS=Mus musculus OX=10090 GN=Ago4 PE=2 SV=2
11	AFDB:Q8CJF9	0.977	0.973	0.000	860	0.848	0.845	Q8CJF9.pdb.gz	AGO3_MOUSE Protein argonaute-3 OS=Mus musculus OX=10090 GN=Ago3 PE=2 SV=2
12	AFDB:Q8CJG1	0.992	0.992	0.000	857	1.000	1.000	Q8CJG1.pdb.gz	AGO1_MOUSE Protein argonaute-1 OS=Mus musculus OX=10090 GN=Ago1 PE=1 SV=2
13	AFDB:D6RUV9	0.913	0.742	4.868E-101	1061	0.440	0.355	D6RUV9.pdb.gz	D6RUV9_TOBAC ARGONAUTE 1 OS=Nicotiana tabacum OX=4097 GN=AGO1 PE=1 SV=1
14	AFDB:Q851R2	0.912	0.743	1.524E-100	1058	0.414	0.336	Q851R2.pdb.gz	MEL1_ORYSJ Protein argonaute MEL1 OS=Oryza sativa subsp. japonica OX=39947 GN=MEL1 PE=2 SV=1
15	AFDB:Q9XGW1	0.917	0.799	2.625E-100	988	0.427	0.370	Q9XGW1.pdb.gz	AGO10_ARATH Protein argonaute 10 OS=Arabidopsis thaliana OX=3702 GN=AGO10 PE=1 SV=1
16	PDB:7swfA	0.729	0.796	1.088E-78	778	0.405	0.446	7swfA.pdb.gz	The molecular mechanism of microRNA duplex selectivity of Arabidopsis ARGONAUTE10.
17	PDB:5guhA	0.688	0.769	1.340E-58	759	0.214	0.241	5guhA.pdb.gz	Crystal Structure of Silkworm PIWI-Clade Argonaute Siwi Bound to piRNA
18	PDB:6kr6A	0.619	0.731	5.854E-50	713	0.211	0.254	6kr6A.pdb.gz	Crystal structure of Drosophila Piwi.
19	PDB:7kpvD	0.459	0.451	4.823E-15	876	0.103	0.100	7kpvD.pdb.gz
20	PDB:1r6zZ	0.115	0.192	2.433E-5	499	0.049	0.084	1r6zZ.pdb.gz	The crystal structure of the Argonaute2 PAZ domain reveals an RNA binding motif in RNAi effector complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A6I8PTZ8	1789	891	1.000	0.962	A0A6I8PTZ8_HUMAN Argonaute RISC component 1 OS=Homo sapiens OX=9606 GN=AGO1 PE=1 SV=1
2	D6RUV9	667	1061	0.432	0.349	D6RUV9_TOBAC ARGONAUTE 1 OS=Nicotiana tabacum OX=4097 GN=AGO1 PE=1 SV=1
3	G5EES3	1222	1023	0.677	0.567	G5EES3_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-1 PE=1 SV=1
4	G5EGR6	1221	1002	0.677	0.579	G5EGR6_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-1 PE=1 SV=1
5	K4I874	1496	873	0.816	0.801	K4I874_DANRE Protein argonaute-2 OS=Danio rerio OX=7955 GN=AGO2 PE=1 SV=1
6	O04379	678	1048	0.425	0.347	AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana OX=3702 GN=AGO1 PE=1 SV=1
7	O16720	1178	910	0.667	0.629	O16720_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-2 PE=1 SV=2
8	Q27IR0	1266	851	0.708	0.713	Q27IR0_DROME Argonaute-1 (Fragment) OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=1 SV=1
9	Q32KD4	1333	984	0.744	0.648	Q32KD4_DROME Argonaute-1, isoform A OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=1 SV=1
10	Q5TA58	1637	782	0.912	1.000	Q5TA58_HUMAN Argonaute RISC component 1 OS=Homo sapiens OX=9606 GN=AGO1 PE=1 SV=1
11	Q69VD5	669	979	0.424	0.371	PNH1_ORYSJ Protein argonaute PNH1 OS=Oryza sativa subsp. japonica OX=39947 GN=PHN1 PE=2 SV=1
12	Q7KY08	1333	950	0.744	0.672	Q7KY08_DROME Argonaute protein OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=1 SV=1
13	Q851R2	635	1058	0.412	0.334	MEL1_ORYSJ Protein argonaute MEL1 OS=Oryza sativa subsp. japonica OX=39947 GN=MEL1 PE=2 SV=1
14	Q86B39	1178	891	0.667	0.642	Q86B39_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-2 PE=1 SV=1
15	Q8CJF8	1475	861	0.824	0.820	AGO4_MOUSE Protein argonaute-4 OS=Mus musculus OX=10090 GN=Ago4 PE=2 SV=2
16	Q8CJF9	1532	860	0.849	0.847	AGO3_MOUSE Protein argonaute-3 OS=Mus musculus OX=10090 GN=Ago3 PE=2 SV=2
17	Q8CJG0	1499	860	0.826	0.823	AGO2_MOUSE Protein argonaute-2 OS=Mus musculus OX=10090 GN=Ago2 PE=1 SV=3
18	Q8CJG1	1789	857	1.000	1.000	AGO1_MOUSE Protein argonaute-1 OS=Mus musculus OX=10090 GN=Ago1 PE=1 SV=2
19	Q8T059	704	424	0.390	0.788	Q8T059_DROME LD26301p OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=2 SV=1
20	Q960T1	956	601	0.533	0.760	Q960T1_DROME LD36719p OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08699 ArgoL1	1.5e-19	80.7	Argonaute linker 1 domain
2	PF16488 ArgoL2	4.6e-12	57.3	Argonaute linker 2 domain
3	PF16487 ArgoMid	6e-31	117.9	Mid domain of argonaute
4	PF16486 ArgoN	3.3e-26	103.9	N-terminal domain of argonaute
5	PF02170 PAZ	1.1e-26	104.9	PAZ domain
6	PF02171 Piwi	2.6e-107	370.2	Piwi domain
7	PF14832 Tautomerase_3	3e+02	13.1	Putative oxalocrotonate tautomerase enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 225400.XP_006777367.1

Rank	PPI partner	STRING score	Description
1	225400.XP_006753670.1	0.992	Trinucleotide repeat-containing protein 6A protein
2	225400.XP_006768031.1	0.992	Belongs to the helicase family. Dicer subfamily.
3	225400.XP_006757033.1	0.983	Required for formation of the RNA induced silencing complex (RISC). Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, AGO2 and TARBP2. Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto AGO2. AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. May also play a role in the production of short interfering RNAs (siRNAs) from double-stranded RNA (dsRNA) by DICER1
4	225400.XP_006758778.1	0.980	Belongs to the DEAD box helicase family.
5	225400.XP_006773029.1	0.959	ATP-dependent RNA helicase A
6	225400.XP_006753347.1	0.956	Required for RNA-mediated gene silencing (RNAi) by the RNA- induced silencing complex (RISC). The 'minimal RISC' appears to include AGO2 bound to a short guide RNA such as a microRNA (miRNA) or short interfering RNA (siRNA). These guide RNAs direct RISC to complementary mRNAs that are targets for RISC-mediated gene silencing. The precise mechanism of gene silencing depends on the degree of complementarity between the miRNA or siRNA and its target. Binding of RISC to a perfectly complementary mRNA generally results in silencing due to endonucleolytic cleavage of the mRNA specifically by [...]
7	225400.XP_006776447.1	0.950	Exportin-5 isoform X1
8	225400.XP_006773095.1	0.944	Eukaryotic translation initiation factor 4E
9	225400.XP_006776042.1	0.943	Trinucleotide repeat containing 6B
10	225400.XP_006762538.1	0.937	Drosha ribonuclease III
11	225400.XP_006756446.1	0.935	Trinucleotide repeat-containing protein 6C protein
12	225400.XP_006755344.1	0.933	mRNA-decapping enzyme 2
13	225400.XP_006777472.1	0.927	Argonaute 3, RISC catalytic component
14	225400.XP_006760638.1	0.919	Interferon-inducible double-stranded RNA-dependent protein kinase activator A isoform X1
15	225400.XP_006757350.1	0.911	Fragile X mental retardation protein 1 homolog isoform X1
16	225400.XP_006759705.1	0.896	LIM domain-containing protein 1
17	225400.XP_006768883.1	0.885	Microprocessor complex subunit DGCR8
18	225400.XP_006777473.1	0.880	Argonaute 4, RISC catalytic component
19	225400.XP_006762318.1	0.868	Wilms tumor protein 1-interacting protein
20	225400.XP_006771467.1	0.861	Staphylococcal nuclease domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0035198	0.999	miRNA binding
GO:0003824	0.917	catalytic activity
GO:0140640	0.872	catalytic activity, acting on a nucleic acid
GO:0140098	0.839	catalytic activity, acting on RNA
GO:0004518	0.820	nuclease activity
GO:0004521	0.814	RNA endonuclease activity
GO:0016891	0.797	RNA endonuclease activity, producing 5'-phosphomonoesters
GO:0003727	0.715	single-stranded RNA binding
GO:0003725	0.661	double-stranded RNA binding
GO:0019899	0.453	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.996	regulation of biological process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0010468	0.990	regulation of gene expression
GO:0048519	0.989	negative regulation of biological process
GO:0043170	0.989	macromolecule metabolic process
GO:0050794	0.988	regulation of cellular process
GO:0051171	0.980	regulation of nitrogen compound metabolic process
GO:0080090	0.978	regulation of primary metabolic process
GO:0016070	0.977	RNA metabolic process
GO:2000112	0.968	regulation of cellular macromolecule biosynthetic process
GO:0048518	0.960	positive regulation of biological process
GO:0070918	0.960	regulatory ncRNA processing
GO:0035196	0.935	miRNA processing
GO:0051172	0.929	negative regulation of nitrogen compound metabolic process
GO:0051246	0.928	regulation of protein metabolic process
GO:0031324	0.927	negative regulation of cellular metabolic process
GO:0010558	0.922	negative regulation of macromolecule biosynthetic process
GO:0034248	0.921	regulation of amide metabolic process
GO:0031327	0.918	negative regulation of cellular biosynthetic process
GO:0010608	0.916	post-transcriptional regulation of gene expression
GO:0048522	0.905	positive regulation of cellular process
GO:0019219	0.893	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.887	positive regulation of nitrogen compound metabolic process
GO:0051252	0.884	regulation of RNA metabolic process
GO:0010604	0.881	positive regulation of macromolecule metabolic process
GO:0006417	0.880	regulation of translation
GO:0031325	0.873	positive regulation of cellular metabolic process
GO:0051248	0.868	negative regulation of protein metabolic process
GO:0045935	0.856	positive regulation of nucleobase-containing compound metabolic process
GO:2000113	0.848	negative regulation of cellular macromolecule biosynthetic process
GO:0071840	0.830	cellular component organization or biogenesis
GO:0017148	0.824	negative regulation of translation
GO:0016441	0.809	post-transcriptional gene silencing
GO:0035194	0.801	RNA-mediated post-transcriptional gene silencing
GO:0051254	0.760	positive regulation of RNA metabolic process
GO:0035195	0.736	miRNA-mediated gene silencing
GO:0032501	0.596	multicellular organismal process
GO:0032502	0.589	developmental process
GO:0016043	0.532	cellular component organization
GO:0048856	0.520	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:1990904	0.998	ribonucleoprotein complex
GO:0036464	0.992	cytoplasmic ribonucleoprotein granule
GO:0005829	0.986	cytosol
GO:0031332	0.959	RNAi effector complex
GO:0031974	0.958	membrane-enclosed lumen
GO:0016442	0.953	RISC complex
GO:0070013	0.950	intracellular organelle lumen
GO:0031981	0.929	nuclear lumen
GO:0005654	0.857	nucleoplasm
GO:1902494	0.638	catalytic complex
GO:0140535	0.352	intracellular protein-containing complex
GO:1905348	0.316	endonuclease complex
GO:0000932	0.315	P-body
GO:1902555	0.309	endoribonuclease complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.820	Acting on ester bonds.
EC:3.1.26.-	0.797	Endoribonucleases producing 5'-phosphomonoesters.

[back to server]