StarFunc result for job id Q9UL25

User Input

>input (225 residues)
MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKK
LNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKM
LGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRM
IETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UL25	1.000	1.000	1.060E-46	225	1.000	1.000	Q9UL25.pdb.gz	RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens OX=9606 GN=RAB21 PE=1 SV=3
2	AFDB:P34142	0.744	0.789	5.580E-31	212	0.569	0.604	P34142.pdb.gz	RAB21_DICDI Ras-related protein Rab-21 OS=Dictyostelium discoideum OX=44689 GN=rab21 PE=1 SV=2
3	AFDB:Q7PLE9	0.760	0.771	6.480E-29	222	0.516	0.523	Q7PLE9.pdb.gz	Q7PLE9_DROME Ras-related protein Rab-21 OS=Drosophila melanogaster OX=7227 GN=Rab21 PE=3 SV=3
4	AFDB:Q7ZVP2	0.760	0.773	1.452E-24	221	0.418	0.425	Q7ZVP2.pdb.gz	Q7ZVP2_DANRE RAB5C, member RAS oncogene family OS=Danio rerio OX=7955 GN=wu:fi16g01 PE=1 SV=1
5	AFDB:P35292	0.774	0.812	4.841E-24	214	0.382	0.402	P35292.pdb.gz	RAB17_MOUSE Ras-related protein Rab-17 OS=Mus musculus OX=10090 GN=Rab17 PE=1 SV=1
6	AFDB:Q9V3I2	0.722	0.741	1.104E-23	219	0.391	0.402	Q9V3I2.pdb.gz	Q9V3I2_DROME Drab5 OS=Drosophila melanogaster OX=7227 GN=Rab5 PE=1 SV=1
7	AFDB:Q5B6I8	0.736	0.759	1.335E-23	218	0.382	0.394	Q5B6I8.pdb.gz	Q5B6I8_EMENI RAB GTPase Ypt5, putative (AFU_orthologue AFUA_4G08040) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03842 PE=4 SV=1
8	AFDB:Q8MYF2	0.776	0.684	2.081E-23	256	0.338	0.297	Q8MYF2.pdb.gz	RABJ_DICDI Ras-related protein RabJ OS=Dictyostelium discoideum OX=44689 GN=rabJ PE=3 SV=1
9	AFDB:Q7ZUG4	0.724	0.753	2.217E-23	216	0.409	0.426	Q7ZUG4.pdb.gz	Q7ZUG4_DANRE RAB5A, member RAS oncogene family like OS=Danio rerio OX=7955 GN=rab5al PE=1 SV=1
10	AFDB:G5EFC1	0.774	0.824	2.362E-23	211	0.320	0.341	G5EFC1.pdb.gz	G5EFC1_CAEEL Rab8 OS=Caenorhabditis elegans OX=6239 GN=rab-8 PE=1 SV=1
11	PDB:5sziA	0.718	0.920	1.225E-20	174	0.298	0.385	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
12	PDB:6if2B	0.725	0.909	6.782E-20	178	0.289	0.365	6if2B.pdb.gz	Rab35/ACAP2 and Rab35/RUSC2 Complex Structures Reveal Molecular Basis for Effector Recognition by Rab35 GTPase.
13	PDB:2ew1A	0.713	0.930	1.278E-19	171	0.324	0.427	2ew1A.pdb.gz	Crystal structure of RAB30 in complex with a GTP analogue
14	PDB:1zbdA	0.700	0.879	4.264E-19	177	0.267	0.339	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
15	PDB:5szjA	0.720	0.920	5.157E-19	175	0.271	0.349	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
16	PDB:5szhB	0.709	0.904	1.614E-18	175	0.262	0.337	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
17	PDB:6s5fA	0.725	0.864	2.362E-18	188	0.280	0.335	6s5fA.pdb.gz	Structure of the human RAB39B in complex with GMPPNP
18	PDB:8a4cB	0.705	0.926	2.516E-18	170	0.276	0.365	8a4cB.pdb.gz	Rep15 interacts with several Rab GTPases and has a distinct fold for a Rab effector.
19	PDB:7e1tB	0.704	0.902	3.922E-18	174	0.289	0.374	7e1tB.pdb.gz	Nde1 is a Rab9 effector for loading late endosomes to cytoplasmic dynein motor complex.
20	PDB:2f9mA	0.727	0.890	6.112E-18	182	0.298	0.368	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UL25	1.50e-168	464	225	1.000	1.000	RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens OX=9606 GN=RAB21 PE=1 SV=3
2	Q6AXT5	4.67e-160	443	223	0.960	0.969	RAB21_RAT Ras-related protein Rab-21 OS=Rattus norvegicus OX=10116 GN=Rab21 PE=2 SV=1
3	P35282	3.28e-159	441	222	0.964	0.977	RAB21_MOUSE Ras-related protein Rab-21 OS=Mus musculus OX=10090 GN=Rab21 PE=1 SV=4
4	P34142	8.59e-85	252	212	0.524	0.557	RAB21_DICDI Ras-related protein Rab-21 OS=Dictyostelium discoideum OX=44689 GN=rab21 PE=1 SV=2
5	Q7PLE9	5.86e-77	233	222	0.484	0.491	Q7PLE9_DROME Ras-related protein Rab-21 OS=Drosophila melanogaster OX=7227 GN=Rab21 PE=3 SV=3
6	Q7PLE8	1.42e-61	192	189	0.396	0.471	Q7PLE8_DROME Rab21, isoform A OS=Drosophila melanogaster OX=7227 GN=Rab21 PE=4 SV=1
7	P51148	1.78e-54	175	216	0.400	0.417	RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens OX=9606 GN=RAB5C PE=1 SV=2
8	P35278	3.35e-54	174	216	0.400	0.417	RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus OX=10090 GN=Rab5c PE=1 SV=2
9	B0BNK1	3.78e-54	174	216	0.400	0.417	B0BNK1_RAT RAB5C, member RAS oncogene family OS=Rattus norvegicus OX=10116 GN=Rab5c PE=4 SV=1
10	P51147	1.11e-53	173	216	0.396	0.412	RAB5C_CANLF Ras-related protein Rab-5C OS=Canis lupus familiaris OX=9615 GN=RAB5C PE=2 SV=1
11	Q7ZUG4	1.14e-53	173	216	0.413	0.431	Q7ZUG4_DANRE RAB5A, member RAS oncogene family like OS=Danio rerio OX=7955 GN=rab5al PE=1 SV=1
12	Q9CQD1	7.02e-53	171	215	0.400	0.419	RAB5A_MOUSE Ras-related protein Rab-5A OS=Mus musculus OX=10090 GN=Rab5a PE=1 SV=1
13	M0RC99	9.72e-53	171	215	0.400	0.419	RAB5A_RAT Ras-related protein Rab-5A OS=Rattus norvegicus OX=10116 GN=Rab5a PE=2 SV=1
14	P20339	2.53e-52	170	215	0.413	0.433	RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens OX=9606 GN=RAB5A PE=1 SV=2
15	P18066	2.73e-52	170	215	0.396	0.414	RAB5A_CANLF Ras-related protein Rab-5A OS=Canis lupus familiaris OX=9615 GN=RAB5A PE=1 SV=1
16	Q0IIG7	4.07e-52	169	215	0.391	0.409	RAB5A_BOVIN Ras-related protein Rab-5A OS=Bos taurus OX=9913 GN=RAB5A PE=1 SV=1
17	P91857	9.26e-52	168	208	0.342	0.370	P91857_CAEEL Ras-related protein Rab-5C OS=Caenorhabditis elegans OX=6239 GN=rab-5 PE=1 SV=1
18	Q7T0S5	1.30e-51	168	215	0.387	0.405	Q7T0S5_XENLA Rab5-prov protein OS=Xenopus laevis OX=8355 GN=rab5c.L PE=2 SV=1
19	Q86JP3	4.54e-51	166	201	0.356	0.398	RAB5A_DICDI Ras-related protein Rab-5A OS=Dictyostelium discoideum OX=44689 GN=rab5A PE=3 SV=1
20	Q7ZVP2	4.70e-51	167	221	0.356	0.362	Q7ZVP2_DANRE RAB5C, member RAS oncogene family OS=Danio rerio OX=7955 GN=wu:fi16g01 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02177 APP_N	1.3e+02	14.3	Amyloid A4 N-terminal heparin-binding
2	PF00025 Arf	4.5e-11	54.0	ADP-ribosylation factor family
3	PF02421 FeoB_N	45	15.0	Ferrous iron transport protein B
4	PF00009 GTP_EFTU	0.44	21.6	Elongation factor Tu GTP binding domain
5	PF04670 Gtr1_RagA	2.1	19.2	Gtr1/RagA G protein conserved region
6	PF01926 MMR_HSR1	0.48	21.9	50S ribosome-binding GTPase
7	PF10662 PduV-EutP	3.2	19.0	Ethanolamine utilisation - propanediol utilisation
8	PF00071 Ras	1.1e-54	195.9	Ras family
9	PF08477 Roc	6.3e-34	128.2	Ras of Complex, Roc, domain of DAPkinase
10	PF03193 RsgA_GTPase	0.097	24.0	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261263

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370208	0.998	RAB guanine nucleotide exchange factor 1
2	9606.ENSP00000304292	0.981	Ankyrin repeat domain-containing protein 27
3	9606.ENSP00000256190	0.975	Myotubularin-related protein 13
4	9606.ENSP00000370196	0.940	Myotubularin-related protein 5
5	9606.ENSP00000288266	0.925	DCC-interacting protein 13-alpha
6	9606.ENSP00000262640	0.884	Vesicle-associated membrane protein 7
7	9606.ENSP00000394071	0.734	Rab GDP dissociation inhibitor alpha
8	9606.ENSP00000317955	0.703	Early endosome antigen 1
9	9606.ENSP00000379350	0.702	Integrin beta-1
10	9606.ENSP00000298316	0.690	ADP-ribosylation factor 6
11	9606.ENSP00000350386	0.689	Rab proteins geranylgeranyltransferase component A 1
12	9606.ENSP00000007722	0.685	Integrin alpha-3
13	9606.ENSP00000369538	0.679	Rab GDP dissociation inhibitor beta
14	9606.ENSP00000366387	0.672	MAM domain containing 2
15	9606.ENSP00000433681	0.660	Condensin-2 complex subunit D3
16	9606.ENSP00000387282	0.655	Arf-GAP domain and FG repeat-containing protein 1
17	9606.ENSP00000355511	0.635	Rab proteins geranylgeranyltransferase component A 2
18	9606.ENSP00000263864	0.624	Vesicle-associated membrane protein 8
19	9606.ENSP00000328551	0.620	Ras-related protein Rab-28
20	9606.ENSP00000445408	0.617	Rab GTPase-binding effector protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019001	0.942	guanyl nucleotide binding
GO:0032561	0.926	guanyl ribonucleotide binding
GO:0043168	0.920	anion binding
GO:0003824	0.906	catalytic activity
GO:0003924	0.894	GTPase activity
GO:0005525	0.886	GTP binding
GO:0019003	0.696	GDP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0046907	0.985	intracellular transport
GO:0051128	0.976	regulation of cellular component organization
GO:0030705	0.976	cytoskeleton-dependent intracellular transport
GO:0099111	0.975	microtubule-based transport
GO:0010970	0.967	transport along microtubule
GO:0050793	0.965	regulation of developmental process
GO:0008088	0.959	axo-dendritic transport
GO:0098930	0.933	axonal transport
GO:0008089	0.892	anterograde axonal transport
GO:0065008	0.883	regulation of biological quality
GO:0032386	0.870	regulation of intracellular transport
GO:0048518	0.779	positive regulation of biological process
GO:0071840	0.774	cellular component organization or biogenesis
GO:0051130	0.763	positive regulation of cellular component organization
GO:0016043	0.758	cellular component organization
GO:1903649	0.751	regulation of cytoplasmic transport
GO:0050767	0.709	regulation of neurogenesis
GO:0022604	0.697	regulation of cell morphogenesis
GO:0060627	0.671	regulation of vesicle-mediated transport
GO:0120035	0.656	regulation of plasma membrane bounded cell projection organization
GO:0010769	0.580	regulation of cell morphogenesis involved in differentiation
GO:0040008	0.561	regulation of growth
GO:0051094	0.555	positive regulation of developmental process
GO:0010720	0.546	positive regulation of cell development
GO:0051962	0.528	positive regulation of nervous system development
GO:0010975	0.509	regulation of neuron projection development
GO:0050769	0.494	positive regulation of neurogenesis
GO:0050773	0.469	regulation of dendrite development
GO:0001558	0.443	regulation of cell growth
GO:0031346	0.395	positive regulation of cell projection organization
GO:0016192	0.353	vesicle-mediated transport
GO:0048259	0.336	regulation of receptor-mediated endocytosis
GO:0045807	0.329	positive regulation of endocytosis
GO:0031647	0.325	regulation of protein stability
GO:0008361	0.305	regulation of cell size
GO:0048814	0.303	regulation of dendrite morphogenesis
GO:0010770	0.303	positive regulation of cell morphogenesis involved in differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.998	endomembrane system
GO:0016020	0.997	membrane
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005737	0.996	cytoplasm
GO:0005886	0.979	plasma membrane
GO:0030054	0.914	cell junction
GO:0005768	0.875	endosome
GO:0031090	0.849	organelle membrane
GO:0005829	0.844	cytosol
GO:0098588	0.708	bounding membrane of organelle
GO:0120025	0.576	plasma membrane bounded cell projection
GO:0045202	0.531	synapse
GO:0005769	0.529	early endosome
GO:0030659	0.527	cytoplasmic vesicle membrane
GO:1903561	0.471	extracellular vesicle
GO:0005794	0.322	Golgi apparatus
GO:0043005	0.316	neuron projection
GO:0010008	0.301	endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.894	GTP + H2O = GDP + H(+) + phosphate

[back to server]