StarFunc result for job id Q9UL36

User Input

>input (1845 residues)
MGLCGLLERCWLHHDPDGVLTLNAENTNYAYQVPNFHKCEICLLSFPKESQFQRHMRDHE
RNDKPHRCDQCPQTFNVEFNLTLHKCTHSGEDPTCPVCNKKFSRVASLKAHIMLHEKEEN
LICSECGDEFTLQSQLAVHMEEHRQELAGTRQHACKACKKEFETSSELKEHMKTHYKIRV
SSTRSYNRNIDRSGFTYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGAL
QTHMIKHTGEKPHACAFCPAAFSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSL
NTHISKMHMGGPQNSTSSTETAHVLTATLFQTLPLQQTEAQATSASSQPSSQAVSDVIQQ
LLELSEPAPVESGQSPQPGQQLSITVGINQDILQQALENSGLSSIPAAAHPNDSCHAKTS
APHAQNPDVSSVSNEQTDPTDAEQEKEQESPEKLDKKEKKMIKKKSPFLPGSIREENGVR
WHVCPYCAKEFRKPSDLVRHIRIHTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKC
QYCMKSFSTSGSLKVHIRLHTGVRPFACPHCDKKFRTSGHRKTHIASHFKHTELRKMRHQ
RKPAKVRVGKTNIPVPDIPLQEPILITDLGLIQPIPKNQFFQSYFNNNFVNEADRPYKCF
YCHRAYKKSCHLKQHIRSHTGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLICNG
AFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKTSLNCKKHMKTHRYELAQQLQQHQQAASI
DDSTVDQQSMQASTQMQVEIESDELPQTAEVVAANPEAMLDLEPQHVVGTEEAGLGQQLA
DQPLEADEDGFVAPQDPLRGHVDQFEEQSPAQQSFEPAGLPQGFTVTDTYHQQPQFPPVQ
QLQDSSTLESQALSTSFHQQSLLQAPSSDGMNVTTRLIQESSQEELDLQAQGSQFLEDNE
DQSRRSYRCDYCNKGFKKSSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGV
KAFSCSVCNASFTTNGSLTRHMATHMSMKPYKCPFCEEGFRTTVHCKKHMKRHQTVPSAV
SATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQESATVSEKVLV
QSAAEKDRISELRDKQAELQDEPKHANCCTYCPKSFKKPSDLVRHVRIHTGEKPYKCDEC
GKSFTVKSTLDCHVKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRF
RTSGRRKTHMQFHYKPDPKKARKPMTRSSSEGLQPVNLLNSSSTDPNVFIMNNSVLTGQF
DQNLLQPGLVGQAILPASVSAGGDLTVSLTDGSLATLEGIQLQLAANLVGPNVQISGIDA
ASINNITLQIDPSILQQTLQQGNLLAQQLTGEPGLAPQNSSLQTSDSTVPASVVIQPISG
LSLQPTVTSANLTIGPLSEQDSVLTTNSSGTQDLTQVMTSQGLVSPSGGPHEITLTINNS
SLSQVLAQAAGPTATSSSGSPQEITLTISELNTTSGSLPSTTPMSPSAISTQNLVMSSSG
VGGDASVTLTLADTQGMLSGGLDTVTLNITSQGQQFPALLTDPSLSGQGGAGSPQVILVS
HTPQSASAACEEIAYQVAGVSGNLAPGNQPEKEGRAHQCLECDRAFSSAAVLMHHSKEVH
GRERIHGCPVCRKAFKRATHLKEHMQTHQAGPSLSSQKPRVFKCDTCEKAFAKPSQLERH
SRIHTGERPFHCTLCEKAFNQKSALQVHMKKHTGERPYKCAYCVMGFTQKSNMKLHMKRA
HSYAGALQESAGHPEQDGEELSRTLHLEEVVQEAAGEWQALTHVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UL36	1.000	1.000	0.000	1845	1.000	1.000	Q9UL36.pdb.gz	ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens OX=9606 GN=ZNF236 PE=1 SV=2
2	AFDB:O15015	0.062	0.062	1.570E-36	1832	0.182	0.183	O15015.pdb.gz	ZN646_HUMAN Zinc finger protein 646 OS=Homo sapiens OX=9606 GN=ZNF646 PE=1 SV=2
3	AFDB:Q92766	0.054	0.058	1.014E-26	1687	0.162	0.177	Q92766.pdb.gz	RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3
4	AFDB:P57071	0.074	0.080	1.565E-25	1507	0.119	0.146	P57071.pdb.gz	PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens OX=9606 GN=PRDM15 PE=1 SV=4
5	AFDB:F1QI36	0.051	0.067	6.056E-20	1313	0.145	0.204	F1QI36.pdb.gz	F1QI36_DANRE Sal-like protein 1 OS=Danio rerio OX=7955 GN=cb896spalt PE=1 SV=1
6	AFDB:Q9NSC2	0.049	0.063	3.681E-19	1324	0.149	0.207	Q9NSC2.pdb.gz	SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens OX=9606 GN=SALL1 PE=1 SV=2
7	AFDB:Q62255	0.051	0.066	7.847E-19	1320	0.146	0.204	Q62255.pdb.gz	SALL3_MOUSE Sal-like protein 3 OS=Mus musculus OX=10090 GN=Sall3 PE=1 SV=2
8	AFDB:A0A0R4INF0	0.048	0.056	1.620E-17	1570	0.126	0.148	A0A0R4INF0.pdb.gz	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
9	AFDB:Q6ZNG0	0.062	0.247	1.929E-17	422	0.054	0.237	Q6ZNG0.pdb.gz	ZN620_HUMAN Zinc finger protein 620 OS=Homo sapiens OX=9606 GN=ZNF620 PE=1 SV=1
10	AFDB:P28166	0.060	0.096	1.011E-15	1054	0.121	0.213	P28166.pdb.gz	ZFH1_DROME Zinc finger protein 1 OS=Drosophila melanogaster OX=7227 GN=zfh1 PE=1 SV=2
11	PDB:3w5kB	0.034	0.274	9.833E-5	110	0.023	0.391	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5dkaA	0.022	0.237	6.100E-1	96	0.010	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
13	PDB:5a31B	0.021	0.226	9.168E-1	84	0.007	0.155	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
14	PDB:7vo0G	0.016	0.171	1.461	131	0.010	0.137	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
15	PDB:7o4iW	0.024	0.084	1.548	312	0.014	0.083	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
16	PDB:3j920	0.014	0.413	1.641	36	0.006	0.306	3j920.pdb.gz	Structure and Assembly Pathway of the Ribosome Quality Control Complex.
17	PDB:5apny	0.024	0.123	2.196	211	0.023	0.199	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:5c8dE	0.018	0.076	2.196	280	0.007	0.046	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
19	PDB:7d58O	0.027	0.055	2.615	490	0.013	0.049	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
20	PDB:7uhyA	0.018	0.036	2.615	771	0.010	0.025	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UL36	0.0	3827	1845	1.000	1.000	ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens OX=9606 GN=ZNF236 PE=1 SV=2
2	Q05481	2.53e-79	290	1191	0.165	0.256	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
3	Q9UII5	1.32e-69	253	783	0.111	0.261	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
4	Q14587	1.88e-68	253	947	0.115	0.224	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
5	Q9P2J8	3.22e-66	245	865	0.102	0.218	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
6	Q7TMN8	2.53e-62	226	578	0.094	0.299	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
7	P51523	8.02e-62	229	738	0.101	0.253	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
8	Q8BLA2	8.28e-62	225	578	0.093	0.298	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
9	Q8TAQ5	6.19e-60	222	688	0.093	0.250	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
10	Q6ZNG1	1.62e-59	222	722	0.099	0.253	ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens OX=9606 GN=ZNF600 PE=1 SV=2
11	Q96JF6	1.96e-59	223	807	0.107	0.244	ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens OX=9606 GN=ZNF594 PE=2 SV=3
12	Q6ZR52	5.86e-59	218	646	0.102	0.291	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3
13	A0A1B0GR71	1.22e-57	220	966	0.105	0.201	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
14	Q5DTF8	1.47e-57	219	919	0.115	0.231	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
15	P17038	1.70e-57	217	809	0.104	0.236	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
16	Q7TPL6	2.09e-57	218	888	0.115	0.239	Q7TPL6_MOUSE Zinc finger protein 748 OS=Mus musculus OX=10090 GN=Zfp748 PE=1 SV=1
17	Q5MCW4	4.95e-57	213	686	0.088	0.236	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
18	B0R156	7.89e-57	212	631	0.098	0.287	B0R156_DANRE Draculin-like, tandem duplicate 3 OS=Danio rerio OX=7955 GN=drl-L3 PE=4 SV=1
19	A0A075BR52	1.09e-56	211	631	0.096	0.281	A0A075BR52_DANRE Draculin-like 3 OS=Danio rerio OX=7955 GN=drl-L3 PE=2 SV=1
20	Q3V1X2	1.64e-56	216	888	0.114	0.238	Q3V1X2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	3.6e-110	365.8	Zinc finger, C2H2 type
2	PF16622 zf-C2H2_11	1.8	19.7	zinc-finger C2H2-type
3	PF12756 zf-C2H2_2	5.5	18.7	C2H2 type zinc-finger (2 copies)
4	PF13894 zf-C2H2_4	7e-84	280.1	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	1.3e-14	65.0	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	2.8e-44	159.8	Zinc-finger double-stranded RNA-binding
7	PF13913 zf-C2HC_2	85	14.5	zinc-finger of a C2HC-type
8	PF16278 zf-C2HE	8.3e+02	11.9	C2HE / C2H2 / C2HC zinc-binding finger
9	PF05605 zf-Di19	0.1	24.2	Drought induced 19 protein (Di19), zinc-binding
10	PF13465 zf-H2C2_2	4.9e-124	411.1	Zinc-finger double domain
11	PF13909 zf-H2C2_5	1.5e+02	13.5	C2H2-type zinc-finger domain
12	PF12874 zf-met	9.8e-05	33.8	Zinc-finger of C2H2 type
13	PF14369 zinc_ribbon_9	0.033	25.8	zinc-ribbon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253159

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299727	0.564	Galanin receptor type 1
2	9606.ENSP00000312457	0.532	Brain and acute leukemia, cytoplasmic
3	9606.ENSP00000323678	0.528	Prostaglandin reductase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.759	nucleic acid binding
GO:0003677	0.317	DNA binding
GO:1990837	0.304	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.973	cellular process
GO:0065007	0.876	biological regulation
GO:0050896	0.843	response to stimulus
GO:0050789	0.840	regulation of biological process
GO:0050794	0.754	regulation of cellular process
GO:0019222	0.672	regulation of metabolic process
GO:0051716	0.633	cellular response to stimulus
GO:0060255	0.615	regulation of macromolecule metabolic process
GO:0009743	0.563	response to carbohydrate
GO:0033500	0.555	carbohydrate homeostasis
GO:0031323	0.506	regulation of cellular metabolic process
GO:0080090	0.503	regulation of primary metabolic process
GO:0051171	0.500	regulation of nitrogen compound metabolic process
GO:0071322	0.431	cellular response to carbohydrate stimulus
GO:0019219	0.424	regulation of nucleobase-containing compound metabolic process
GO:0034284	0.416	response to monosaccharide
GO:0010468	0.408	regulation of gene expression
GO:0001678	0.405	intracellular glucose homeostasis
GO:0071326	0.401	cellular response to monosaccharide stimulus
GO:0009749	0.394	response to glucose
GO:0010556	0.386	regulation of macromolecule biosynthetic process
GO:0031326	0.386	regulation of cellular biosynthetic process
GO:0051252	0.386	regulation of RNA metabolic process
GO:0071333	0.380	cellular response to glucose stimulus
GO:0006355	0.331	regulation of DNA-templated transcription
GO:0048518	0.303	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.872	intracellular organelle lumen
GO:0031981	0.839	nuclear lumen
GO:0005654	0.777	nucleoplasm
GO:0005737	0.743	cytoplasm
GO:0016020	0.352	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]