StarFunc result for job id Q9UL49

User Input

>input (500 residues)
MSGPGPREPPPEAGAAGGEAAVEGAGGGDAALGEPGLSFTTTDLSLVEMTEVEYTQLQHI
LCSHMEAAADGELETRLNSALLAAAGPGAGAGGFAAGGQGGAAPVYPVLCPSALAADAPC
LGHIDFQELRMMLLSEAGAAEKTSGGGDGARARADGAAKEGAGAAAAAAGPDGAPEARAK
PAVRVRLEDRFNSIPAEPPPAPRGPEPPEPGGALNNLVTLIRHPSELMNVPLQQQNKCTA
LVKNKTAATTTALQFTYPLFTTNACSTSGNSNLSQTQSSSNSCSVLEAAKHQDIGLPRAF
SFCYQQEIESTKQTLGSRNKVLPEQVWIKVGEAALCKQALKRNRSRMRQLDTNVERRALG
EIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRICC
DELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPD
SLVTCPAQGSLQSSPSMEIK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UL49	1.000	1.000	1.886E-72	500	1.000	1.000	Q9UL49.pdb.gz	TCFL5_HUMAN Transcription factor-like 5 protein OS=Homo sapiens OX=9606 GN=TCFL5 PE=2 SV=2
2	AFDB:Q32NY8	0.312	0.318	1.786E-54	489	0.870	0.890	Q32NY8.pdb.gz	Q32NY8_MOUSE Tcfl5 protein OS=Mus musculus OX=10090 GN=Tcfl5 PE=1 SV=1
3	AFDB:P36956	0.134	0.067	9.231E-3	1147	0.184	0.080	P36956.pdb.gz	SRBP1_HUMAN Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1 PE=1 SV=2
4	AFDB:C8VUD1	0.073	0.074	3.644E-2	492	0.134	0.136	C8VUD1.pdb.gz	C8VUD1_EMENI C2H2 finger domain transcription factor (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00273 PE=4 SV=1
5	AFDB:O43019	0.121	0.085	4.434E-2	793	0.162	0.102	O43019.pdb.gz	SRE2_SCHPO Putative transcription factor sre2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sre2 PE=1 SV=1
6	AFDB:Q9BYH8	0.052	0.040	4.734E-2	718	0.126	0.088	Q9BYH8.pdb.gz	IKBZ_HUMAN NF-kappa-B inhibitor zeta OS=Homo sapiens OX=9606 GN=NFKBIZ PE=1 SV=1
7	AFDB:Q64127	0.076	0.044	1.037E-1	1051	0.116	0.055	Q64127.pdb.gz	TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus OX=10090 GN=Trim24 PE=1 SV=1
8	AFDB:Q5VWT5	0.069	0.054	1.439E-1	728	0.118	0.081	Q5VWT5.pdb.gz	FYB2_HUMAN FYN-binding protein 2 OS=Homo sapiens OX=9606 GN=FYB2 PE=1 SV=1
9	AFDB:P0CG20	0.070	0.063	1.751E-1	571	0.168	0.147	P0CG20.pdb.gz	PRR35_HUMAN Proline-rich protein 35 OS=Homo sapiens OX=9606 GN=PRR35 PE=1 SV=1
10	AFDB:Q01098	0.069	0.034	1.751E-1	1239	0.140	0.056	Q01098.pdb.gz	NMDE3_MOUSE Glutamate receptor ionotropic, NMDA 2C OS=Mus musculus OX=10090 GN=Grin2c PE=1 SV=2
11	PDB:6lo8E	0.074	0.282	4.587	80	0.024	0.150	6lo8E.pdb.gz
12	PDB:2rvqC	0.065	0.146	9.416	133	0.038	0.143	2rvqC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q32NY8	0.0	719	489	0.800	0.818	Q32NY8_MOUSE Tcfl5 protein OS=Mus musculus OX=10090 GN=Tcfl5 PE=1 SV=1
2	Q810E9	0.0	690	442	0.768	0.869	Q810E9_MOUSE Factor in the germline beta OS=Mus musculus OX=10090 GN=Tcfl5 PE=2 SV=1
3	Q9UL49	0.0	1018	500	1.000	1.000	TCFL5_HUMAN Transcription factor-like 5 protein OS=Homo sapiens OX=9606 GN=TCFL5 PE=2 SV=2
4	Q3V133	1.92e-159	455	279	0.478	0.857	Q3V133_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Tcfl5 PE=2 SV=1
5	E9Q5K1	4.93e-66	216	292	0.344	0.589	E9Q5K1_MOUSE Transcription factor-like 5 (basic helix-loop-helix) OS=Mus musculus OX=10090 GN=Tcfl5 PE=1 SV=1
6	Q9NX45	6.80e-05	47.8	425	0.048	0.056	SOLH2_HUMAN Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2 OS=Homo sapiens OX=9606 GN=SOHLH2 PE=2 SV=2
7	Q10CH5	0.002	42.7	410	0.058	0.071	PIL13_ORYSJ Transcription factor PHYTOCHROME INTERACTING FACTOR-LIKE 13 OS=Oryza sativa subsp. japonica OX=39947 GN=PIL13 PE=1 SV=1
8	Q8GZM7	0.003	42.4	478	0.068	0.071	PIF1_ARATH Transcription factor PIF1 OS=Arabidopsis thaliana OX=3702 GN=PIF1 PE=1 SV=1
9	Q0JNI9	0.009	41.2	637	0.050	0.039	PIL15_ORYSJ Transcription factor PHYTOCHROME INTERACTING FACTOR-LIKE 15 OS=Oryza sativa subsp. japonica OX=39947 GN=PIL15 PE=1 SV=2
10	Q9D489	0.011	40.8	467	0.042	0.045	SOLH2_MOUSE Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2 OS=Mus musculus OX=10090 GN=Sohlh2 PE=1 SV=2
11	Q8GRJ1	0.014	40.4	417	0.048	0.058	Q8GRJ1_ORYSJ Transcription factor BHLH9-like protein OS=Oryza sativa subsp. japonica OX=39947 GN=OJ1343_B12.103 PE=3 SV=1
12	O08789	0.015	40.4	591	0.056	0.047	MNT_MOUSE Max-binding protein MNT OS=Mus musculus OX=10090 GN=Mnt PE=2 SV=2
13	Q7KM13	0.016	40.0	425	0.050	0.059	HEY_DROME Hairy/enhancer-of-split related with YRPW motif protein OS=Drosophila melanogaster OX=7227 GN=Hey PE=2 SV=1
14	Q9HAP2	0.017	40.4	919	0.046	0.025	MLXIP_HUMAN MLX-interacting protein OS=Homo sapiens OX=9606 GN=MLXIP PE=1 SV=2
15	O80536	0.020	40.0	524	0.046	0.044	PIF3_ARATH Transcription factor PIF3 OS=Arabidopsis thaliana OX=3702 GN=PIF3 PE=1 SV=1
16	Q9EPW1	0.022	40.0	626	0.044	0.035	BMAL1_RAT Basic helix-loop-helix ARNT-like protein 1 OS=Rattus norvegicus OX=10116 GN=Bmal1 PE=2 SV=4
17	O00327	0.024	39.7	626	0.044	0.035	BMAL1_HUMAN Basic helix-loop-helix ARNT-like protein 1 OS=Homo sapiens OX=9606 GN=BMAL1 PE=1 SV=2
18	Q99583	0.024	39.7	582	0.046	0.040	MNT_HUMAN Max-binding protein MNT OS=Homo sapiens OX=9606 GN=MNT PE=1 SV=1
19	Q9I879	0.024	39.7	626	0.050	0.040	Q9I879_DANRE Aryl hydrocarbon receptor nuclear translocator-like 1a OS=Danio rerio OX=7955 GN=bmal1a PE=1 SV=1
20	Q9I8T7	0.024	39.7	633	0.044	0.035	BMAL1_CHICK Basic helix-loop-helix ARNT-like protein 1 OS=Gallus gallus OX=9031 GN=BMAL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	1.2e-07	42.9	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334294

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252729	0.705	Voltage-dependent calcium channel gamma-6 subunit
2	9606.ENSP00000225728	0.678	Mediator of RNA polymerase II transcription subunit 31
3	9606.ENSP00000299492	0.632	Liprin-beta-2
4	9606.ENSP00000347486	0.613	MORN repeat containing 3
5	9606.ENSP00000337946	0.598	Parkin coregulated gene protein
6	9606.ENSP00000401867	0.595	Max dimerization protein 3
7	9606.ENSP00000318085	0.575	Histone H4 transcription factor
8	9606.ENSP00000346886	0.556	GA-binding protein alpha chain
9	9606.ENSP00000463287	0.552	Kruppel like factor 14
10	9606.ENSP00000453302	0.549	Disintegrin and metalloproteinase domain-containing protein 8
11	9606.ENSP00000357873	0.514	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043565	0.998	sequence-specific DNA binding
GO:0003700	0.993	DNA-binding transcription factor activity
GO:0000976	0.991	transcription cis-regulatory region binding
GO:0000981	0.978	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.974	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0005515	0.942	protein binding
GO:0000987	0.927	cis-regulatory region sequence-specific DNA binding
GO:0001217	0.915	DNA-binding transcription repressor activity
GO:0001227	0.914	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000978	0.911	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0080090	0.983	regulation of primary metabolic process
GO:0031323	0.983	regulation of cellular metabolic process
GO:0009987	0.978	cellular process
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0010468	0.974	regulation of gene expression
GO:0010556	0.972	regulation of macromolecule biosynthetic process
GO:0031326	0.972	regulation of cellular biosynthetic process
GO:0044238	0.971	primary metabolic process
GO:0051252	0.966	regulation of RNA metabolic process
GO:0045892	0.962	negative regulation of DNA-templated transcription
GO:0044237	0.957	cellular metabolic process
GO:0043170	0.951	macromolecule metabolic process
GO:0006807	0.950	nitrogen compound metabolic process
GO:0032502	0.941	developmental process
GO:1901362	0.941	organic cyclic compound biosynthetic process
GO:0010467	0.936	gene expression
GO:0044249	0.936	cellular biosynthetic process
GO:0009059	0.926	macromolecule biosynthetic process
GO:0006357	0.923	regulation of transcription by RNA polymerase II
GO:0019438	0.918	aromatic compound biosynthetic process
GO:0032501	0.915	multicellular organismal process
GO:0046483	0.836	heterocycle metabolic process
GO:0034641	0.836	cellular nitrogen compound metabolic process
GO:0034654	0.825	nucleobase-containing compound biosynthetic process
GO:0090304	0.785	nucleic acid metabolic process
GO:0097659	0.771	nucleic acid-templated transcription
GO:0006351	0.753	DNA-templated transcription
GO:0000003	0.497	reproduction
GO:0022414	0.453	reproductive process
GO:0019953	0.437	sexual reproduction
GO:0003006	0.419	developmental process involved in reproduction
GO:0007276	0.419	gamete generation
GO:0007283	0.392	spermatogenesis
GO:0048518	0.347	positive regulation of biological process
GO:0000122	0.340	negative regulation of transcription by RNA polymerase II
GO:0006366	0.337	transcription by RNA polymerase II
GO:0045595	0.329	regulation of cell differentiation
GO:0048522	0.327	positive regulation of cellular process
GO:0010604	0.326	positive regulation of macromolecule metabolic process
GO:0051173	0.320	positive regulation of nitrogen compound metabolic process
GO:0031325	0.320	positive regulation of cellular metabolic process
GO:0042127	0.300	regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.363	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]