StarFunc result for job id Q9UL51

User Input

>input (889 residues)
MDARGGGGRPGESPGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPPRAEA
LPPEAADEGGPRGRLRSRDSSCGRPGTPGAASTAKGSPNGECGRGEPQCSPAGPEGPARG
PKVSFSCRGAASGPAPGPGPAEEAGSEEAGPAGEPRGSQASFMQRQFGALLQPGVNKFSL
RMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDET
TAPWIVFNVVSDTFFLMDLVLNFRTGIVIEDNTEIILDPEKIKKKYLRTWFVVDFVSSIP
VDYIFLIVEKGIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDL
ASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPRNCWVSINGMVNHSWSELYSFALFK
AMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKY
KQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVA
SMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMK
LSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRL
DRIGKKNSILLHKVQHDLNSGVFNNQENAIIQEIVKYDREMVQQAELGQRVGLFPPPPPP
PQVTSAIATLQQAAAMSFCPQVARPLVGPLALGSPRLVRRPPPGPAPAAASPGPPPPASP
PGAPASPRAPRTSPYGGLPAAPLAGPALPARRLSRASRPLSASQPSLPHGAPGPAASTRP
ASSSTPRLGPTPAARAAAPSPDRRDSASPGAAGGLDPQDSARSRLSSNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UL51	0.999	0.999	0.000	889	1.000	1.000	Q9UL51.pdb.gz	HCN2_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Homo sapiens OX=9606 GN=HCN2 PE=1 SV=3
2	AFDB:O60741	0.625	0.624	6.274E-79	890	0.589	0.589	O60741.pdb.gz	HCN1_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Homo sapiens OX=9606 GN=HCN1 PE=1 SV=3
3	AFDB:A0A2R8QRD5	0.633	0.529	1.076E-78	1065	0.618	0.515	A0A2R8QRD5.pdb.gz
4	AFDB:Q24278	0.403	0.515	6.739E-28	665	0.163	0.218	Q24278.pdb.gz	CNGA_DROME Cyclic nucleotide-gated cation channel subunit A OS=Drosophila melanogaster OX=7227 GN=CngA PE=2 SV=2
5	AFDB:Q9ER33	0.403	0.510	7.049E-28	670	0.174	0.231	Q9ER33.pdb.gz	Q9ER33_RAT Cyclic nucleotide gated channel subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Cnga3 PE=4 SV=1
6	AFDB:Q0GFG2	0.418	0.533	5.518E-26	673	0.155	0.205	Q0GFG2.pdb.gz	Q0GFG2_DANRE Cyclic nucleotide-gated channel CNGA5 OS=Danio rerio OX=7955 GN=cnga5 PE=2 SV=1
7	AFDB:Q03611	0.421	0.497	5.714E-25	733	0.151	0.183	Q03611.pdb.gz	CNG_CAEEL Cyclic nucleotide-gated cation channel OS=Caenorhabditis elegans OX=6239 GN=tax-4 PE=1 SV=3
8	PDB:7rhsA	0.382	0.663	1.515E-23	456	0.135	0.263	7rhsA.pdb.gz
9	AFDB:Q9LDR2	0.430	0.510	7.594E-22	729	0.138	0.169	Q9LDR2.pdb.gz	CNG19_ARATH Putative cyclic nucleotide-gated ion channel 19 OS=Arabidopsis thaliana OX=3702 GN=CNGC19 PE=3 SV=1
10	AFDB:P92960	0.436	0.568	1.138E-21	662	0.125	0.168	P92960.pdb.gz	KAT3_ARATH Potassium channel KAT3 OS=Arabidopsis thaliana OX=3702 GN=KAT3 PE=1 SV=1
11	PDB:7n15A	0.378	0.591	3.335E-21	520	0.117	0.200	7n15A.pdb.gz	Structural and functional characterization of an achromatopsia-associated mutation in a phototransduction channel.
12	PDB:7rhsD	0.335	0.582	6.415E-19	441	0.125	0.252	7rhsD.pdb.gz
13	PDB:7wswA	0.382	0.650	8.402E-19	472	0.100	0.189	7wswA.pdb.gz
14	PDB:7o4hB	0.388	0.666	9.100E-18	468	0.135	0.256	7o4hB.pdb.gz
15	PDB:7xufA	0.348	0.580	1.707E-17	476	0.103	0.193	7xufA.pdb.gz
16	PDB:7calA	0.409	0.767	6.879E-17	444	0.101	0.203	7calA.pdb.gz
17	PDB:7o4hD	0.291	0.598	3.892E-14	383	0.096	0.222	7o4hD.pdb.gz
18	AFDB:A0A1W2PPA2	0.211	0.305	4.537E-11	605	0.098	0.144	A0A1W2PPA2.pdb.gz	A0A1W2PPA2_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
19	PDB:6eo1A	0.149	0.318	7.598E-9	355	0.080	0.200	6eo1A.pdb.gz
20	PDB:4ev0D	0.132	0.510	3.664E-8	214	0.054	0.224	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IRW0	991	908	0.585	0.573	A0A0R4IRW0_DANRE Hyperpolarization-activated cyclic nucleotide-gated potassium channel 1 OS=Danio rerio OX=7955 GN=LOC100334297 PE=3 SV=1
2	A1Z9N7	669	1327	0.367	0.246	A1Z9N7_DROME I[[h]] channel, isoform E OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
3	A1Z9N8	683	1290	0.367	0.253	A1Z9N8_DROME I[[h]] channel, isoform B OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
4	A1Z9P0	668	601	0.367	0.542	A1Z9P0_DROME I[[h]] channel, isoform I OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
5	B7YZE7	681	1295	0.367	0.252	B7YZE7_DROME I[[h]] channel, isoform F OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
6	B7YZE8	671	1322	0.367	0.247	B7YZE8_DROME I[[h]] channel, isoform G OS=Drosophila melanogaster OX=7227 GN=Ih PE=3 SV=1
7	O60741	995	890	0.595	0.594	HCN1_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Homo sapiens OX=9606 GN=HCN1 PE=1 SV=3
8	O70507	1006	1186	0.566	0.424	HCN4_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Mus musculus OX=10090 GN=Hcn4 PE=1 SV=2
9	O88703	1416	863	0.904	0.932	HCN2_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Mus musculus OX=10090 GN=Hcn2 PE=1 SV=1
10	O88704	989	910	0.558	0.545	HCN1_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Mus musculus OX=10090 GN=Hcn1 PE=1 SV=1
11	O88705	894	779	0.538	0.614	HCN3_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 OS=Mus musculus OX=10090 GN=Hcn3 PE=1 SV=1
12	Q56JH7	669	1319	0.367	0.247	Q56JH7_DROME Hyperpolarization-activated ion channel variant DMIH-A1B2C2 OS=Drosophila melanogaster OX=7227 GN=Ih PE=2 SV=1
13	Q56JH8	669	627	0.367	0.520	Q56JH8_DROME Hyperpolarization-activated ion channel variant DMIH-A3B1C1 OS=Drosophila melanogaster OX=7227 GN=Ih PE=2 SV=1
14	Q56JH9	669	618	0.367	0.528	Q56JH9_DROME Hyperpolarization-activated ion channel variant DMIH-A2B1C1 OS=Drosophila melanogaster OX=7227 GN=Ih PE=2 SV=1
15	Q56JI0	683	1282	0.367	0.254	Q56JI0_DROME Hyperpolarization-activated ion channel variant DMIH-A1B1C1 OS=Drosophila melanogaster OX=7227 GN=Ih PE=2 SV=1
16	Q9JKA7	1051	1198	0.587	0.436	HCN4_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Rattus norvegicus OX=10116 GN=Hcn4 PE=1 SV=1
17	Q9JKA8	883	780	0.535	0.610	HCN3_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 OS=Rattus norvegicus OX=10116 GN=Hcn3 PE=1 SV=1
18	Q9JKA9	1420	863	0.903	0.930	HCN2_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Rattus norvegicus OX=10116 GN=Hcn2 PE=1 SV=3
19	Q9JKB0	992	910	0.573	0.559	HCN1_RAT Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Rattus norvegicus OX=10116 GN=Hcn1 PE=2 SV=1
20	Q9P1Z3	885	774	0.546	0.627	HCN3_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 OS=Homo sapiens OX=9606 GN=HCN3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	2.3e-14	64.6	Cyclic nucleotide-binding domain
2	PF00520 Ion_trans	4.5e-18	76.9	Ion transport protein
3	PF07885 Ion_trans_2	59	15.0	Ion channel
4	PF08412 Ion_trans_N	2.7e-17	73.4	Ion transport protein N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251287

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261917	0.954	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
2	9606.ENSP00000307342	0.946	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1
3	9606.ENSP00000419975	0.920	PEX5-related protein
4	9606.ENSP00000345001	0.822	CREB-regulated transcription coactivator 1
5	9606.ENSP00000357342	0.816	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3
6	9606.ENSP00000215530	0.767	Fibroblast growth factor 22
7	9606.ENSP00000176183	0.765	Dopamine receptor D4
8	9606.ENSP00000270233	0.676	Basal cell adhesion molecule
9	9606.ENSP00000234798	0.675	Tryptase gamma
10	9606.ENSP00000362680	0.638	Proto-oncogene tyrosine-protein kinase Src
11	9606.ENSP00000381339	0.616	Guanine nucleotide-binding protein G(t) subunit alpha-3
12	9606.ENSP00000228468	0.585	Acid-sensing ion channel 1
13	9606.ENSP00000446205	0.563	Transcription factor HES-7
14	9606.ENSP00000300086	0.554	Telomeric repeat-binding factor 2-interacting protein 1
15	9606.ENSP00000444948	0.541	Potassium channel subfamily K member 4
16	9606.ENSP00000345436	0.530	Caskin-1
17	9606.ENSP00000413496	0.526	Fibroblast growth factor 12
18	9606.ENSP00000433109	0.522	Potassium voltage-gated channel subfamily A member 2
19	9606.ENSP00000328511	0.518	Potassium voltage-gated channel subfamily A member 4
20	9606.ENSP00000265969	0.501	Potassium voltage-gated channel subfamily C member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0015276	0.995	ligand-gated monoatomic ion channel activity
GO:0005272	0.995	sodium channel activity
GO:0005249	0.995	voltage-gated potassium channel activity
GO:0005248	0.993	voltage-gated sodium channel activity
GO:0042802	0.992	identical protein binding
GO:0005221	0.990	intracellular cyclic nucleotide activated monoatomic cation channel activity
GO:0005222	0.577	intracellular cAMP-activated cation channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0065007	0.988	biological regulation
GO:0050794	0.983	regulation of cellular process
GO:0050896	0.978	response to stimulus
GO:0051716	0.963	cellular response to stimulus
GO:0042391	0.927	regulation of membrane potential
GO:0003254	0.919	regulation of membrane depolarization
GO:0046683	0.913	response to organophosphorus
GO:0071805	0.913	potassium ion transmembrane transport
GO:0014074	0.907	response to purine-containing compound
GO:1901701	0.858	cellular response to oxygen-containing compound
GO:0071407	0.855	cellular response to organic cyclic compound
GO:0071495	0.846	cellular response to endogenous stimulus
GO:0051591	0.759	response to cAMP
GO:1901699	0.755	cellular response to nitrogen compound
GO:0071320	0.742	cellular response to cAMP
GO:0032501	0.678	multicellular organismal process
GO:0007154	0.626	cell communication
GO:0023052	0.613	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:1990351	0.998	transporter complex
GO:0098796	0.996	membrane protein complex
GO:0008076	0.985	voltage-gated potassium channel complex
GO:0042995	0.556	cell projection
GO:0005622	0.540	intracellular anatomical structure
GO:0120025	0.540	plasma membrane bounded cell projection
GO:0043005	0.467	neuron projection
GO:0098855	0.391	HCN channel complex
GO:0005737	0.323	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.995	Na(+)(in) = Na(+)(out)
RHEA:29463	0.995	K(+)(in) = K(+)(out)

[back to server]