StarFunc result for job id Q9UL54

User Input

>input (1235 residues)
MPAGGRAGSLKDPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMS
YSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHK
KPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPAN
SFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQN
ESPVLQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDA
VRELDNLQYRKMKKILFQEAPNGPGAEAPEEEEEAEPYMHRAGTLTSLESSHSVPSMSIS
ASSQSSSVNSLADASDNEEEEEEEEEEEEEEEGPEAREMAMMQEGEHTVTSHSSIIHRLP
GSDNLYDDPYQPEITPSPLQPPAAPAPTSTTSSARRRAYCRNRDHFATIRTASLVSRQIQ
EHEQDSALREQLSGYKRMRRQHQKQLLALESRLRGEREEHSARLQRELEAQRAGFGAEAE
KLARRHQAIGEKEARAAQAEERKFQQHILGQQKKELAALLEAQKRTYKLRKEQLKEELQE
NPSTPKREKAEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQD
LLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEY
NKRREQELRQKHAAQVRQQPKSLKVRAGQRPPGLPLPIPGALGPPNTGTPIEQQPCSPGQ
EAVLDQRMLGEEEEAVGERRILGKEGATLEPKQQRILGEESGAPSPSPQKHGSLVDEEVW
GLPEEIEELRVPSLVPQERSIVGQEEAGTWSLWGKEDESLLDEEFELGWVQGPALTPVPE
EEEEEEEGAPIGTPRDPGDGCPSPDIPPEPPPTHLRPCPASQLPGLLSHGLLAGLSFAVG
SSSGLLPLLLLLLLPLLAAQGGGGLQAALLALEVGLVGLGASYLLLCTALHLPSSLFLLL
AQGTALGAVLGLSWRRGLMGVPLGLGAAWLLAWPGLALPLVAMAAGGRWVRQQGPRVRRG
ISRLWLRVLLRLSPMAFRALQGCGAVGDRGLFALYPKTNKDGFRSRLPVPGPRRRNPRTT
QHPLALLARVWVLCKGWNWRLARASQGLASHLPPWAIHTLASWGLLRGERPTRIPRLLPR
SQRQLGPPASRQPLPGTLAGRRSRTRQSRALPPWR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZQ29	0.540	0.538	0.000	1240	0.919	0.915	Q6ZQ29.pdb.gz	TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus OX=10090 GN=Taok2 PE=1 SV=3
2	AFDB:A0A0R4IIN0	0.298	0.326	1.031E-74	1121	0.498	0.549	A0A0R4IIN0.pdb.gz	A0A0R4IIN0_DANRE Serine/threonine-protein kinase TAO2 isoform X4 OS=Danio rerio OX=7955 GN=taok2b PE=4 SV=2
3	AFDB:X1WD79	0.283	0.306	1.597E-73	1138	0.495	0.537	X1WD79.pdb.gz	X1WD79_DANRE Serine/threonine-protein kinase TAO2 isoform X2 OS=Danio rerio OX=7955 GN=taok2a PE=1 SV=1
4	AFDB:O88664	0.283	0.345	4.752E-67	1001	0.441	0.544	O88664.pdb.gz	TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus OX=10116 GN=Taok1 PE=1 SV=1
5	AFDB:Q9H2K8	0.273	0.368	2.165E-62	898	0.377	0.518	Q9H2K8.pdb.gz	TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens OX=9606 GN=TAOK3 PE=1 SV=2
6	AFDB:Q0KHQ5	0.288	0.339	1.860E-53	1039	0.315	0.374	Q0KHQ5.pdb.gz	TAO_DROME Serine/threonine-protein kinase Tao OS=Drosophila melanogaster OX=7227 GN=Tao PE=1 SV=1
7	AFDB:P46549	0.292	0.362	1.733E-47	982	0.240	0.301	P46549.pdb.gz	SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans OX=6239 GN=kin-18 PE=1 SV=1
8	AFDB:O24527	0.225	0.330	9.525E-26	836	0.125	0.184	O24527.pdb.gz	SIK1_ARATH Serine/threonine-protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=SIK1 PE=1 SV=1
9	AFDB:Q9JM52	0.225	0.212	7.349E-25	1308	0.178	0.168	Q9JM52.pdb.gz	MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3
10	AFDB:F1LP90	0.223	0.207	7.698E-25	1336	0.172	0.159	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
11	PDB:4eomC	0.195	0.816	1.599E-16	276	0.063	0.283	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
12	PDB:3eqdA	0.202	0.747	6.148E-16	315	0.069	0.270	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
13	PDB:5u6yA	0.190	0.487	2.594E-15	459	0.062	0.168	5u6yA.pdb.gz
14	PDB:3c4wB	0.203	0.467	3.272E-15	519	0.055	0.131	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
15	PDB:5x3fB	0.196	0.643	4.127E-15	349	0.053	0.189	5x3fB.pdb.gz
16	PDB:4yc3A	0.191	0.746	5.453E-15	295	0.055	0.231	4yc3A.pdb.gz
17	PDB:6byrA	0.206	0.600	1.094E-14	405	0.054	0.165	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
18	PDB:2yaaA	0.203	0.781	1.146E-14	300	0.058	0.240	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
19	PDB:4krcA	0.190	0.754	1.146E-14	297	0.053	0.219	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
20	PDB:4rerA	0.191	0.493	1.201E-14	459	0.061	0.163	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IIN0	0.0	1142	1121	0.470	0.517	A0A0R4IIN0_DANRE Serine/threonine-protein kinase TAO2 isoform X4 OS=Danio rerio OX=7955 GN=taok2b PE=4 SV=2
2	E1BHE1	0.0	893	874	0.363	0.513	E1BHE1_BOVIN TAO kinase 3 OS=Bos taurus OX=9913 GN=TAOK3 PE=4 SV=2
3	O88664	0.0	1051	1001	0.442	0.545	TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus OX=10116 GN=Taok1 PE=1 SV=1
4	Q5F2E8	0.0	1050	1001	0.441	0.544	TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus OX=10090 GN=Taok1 PE=1 SV=1
5	Q6ZQ29	0.0	2061	1240	0.921	0.918	TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus OX=10090 GN=Taok2 PE=1 SV=3
6	Q7L7X3	0.0	1046	1001	0.440	0.542	TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens OX=9606 GN=TAOK1 PE=1 SV=1
7	Q9H2K8	0.0	934	898	0.379	0.521	TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens OX=9606 GN=TAOK3 PE=1 SV=2
8	Q9JLS3	0.0	2030	1235	0.923	0.923	TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus OX=10116 GN=Taok2 PE=1 SV=1
9	Q9UL54	0.0	2486	1235	1.000	1.000	TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens OX=9606 GN=TAOK2 PE=1 SV=2
10	X1WD79	0.0	1142	1138	0.470	0.511	X1WD79_DANRE Serine/threonine-protein kinase TAO2 isoform X2 OS=Danio rerio OX=7955 GN=taok2a PE=1 SV=1
11	P46549	2.25e-165	520	982	0.243	0.305	SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans OX=6239 GN=kin-18 PE=1 SV=1
12	Q0KHQ5	2.63e-163	516	1039	0.196	0.233	TAO_DROME Serine/threonine-protein kinase Tao OS=Drosophila melanogaster OX=7227 GN=Tao PE=1 SV=1
13	O24527	3.78e-70	254	836	0.103	0.152	SIK1_ARATH Serine/threonine-protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=SIK1 PE=1 SV=1
14	O61125	1.87e-66	234	461	0.097	0.260	STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum OX=44689 GN=krsA PE=1 SV=1
15	Q7ZUQ3	1.87e-65	232	492	0.098	0.246	STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio OX=7955 GN=stk3 PE=2 SV=1
16	Q5U0E6	1.15e-64	228	431	0.103	0.295	Q5U0E6_HUMAN Epididymis secretory protein Li 95 OS=Homo sapiens OX=9606 GN=HEL-S-95 PE=2 SV=1
17	Q9Y6E0	1.22e-64	228	443	0.103	0.287	STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24 PE=1 SV=1
18	B0LT89	1.44e-64	228	431	0.102	0.292	STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus OX=10116 GN=Stk24 PE=2 SV=1
19	Q13043	2.01e-64	229	487	0.096	0.244	STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=STK4 PE=1 SV=2
20	Q9JI11	2.17e-64	229	487	0.096	0.244	STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Stk4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.075	23.7	ABC1 atypical kinase-like domain
2	PF00069 Pkinase	2e-59	212.7	Protein kinase domain
3	PF17667 Pkinase_fungal	2e+02	12.2	Fungal protein kinase
4	PF07714 PK_Tyr_Ser-Thr	6.1e-40	148.7	Protein tyrosine and serine/threonine kinase
5	PF01163 RIO1	3.5e+02	12.2	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310094

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345083	0.978	Dual specificity mitogen-activated protein kinase kinase 3
2	9606.ENSP00000468348	0.976	Dual specificity mitogen-activated protein kinase kinase 6
3	9606.ENSP00000278616	0.909	Serine-protein kinase ATM
4	9606.ENSP00000261716	0.902	Serine/threonine-protein kinase TAO1
5	9606.ENSP00000376317	0.902	Serine/threonine-protein kinase TAO3
6	9606.ENSP00000265371	0.737	Neuropilin-1
7	9606.ENSP00000324729	0.732	Protein salvador homolog 1
8	9606.ENSP00000375777	0.705	Striatin-4
9	9606.ENSP00000455785	0.689	BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1
10	9606.ENSP00000311447	0.674	Aspartate beta-hydroxylase domain containing 1
11	9606.ENSP00000326519	0.671	PAXIP1 associated glutamate rich protein 1
12	9606.ENSP00000476774	0.671	PAXIP1-associated glutamate-rich protein 1
13	9606.ENSP00000481917	0.652	Seizure 6-like protein 2
14	9606.ENSP00000340017	0.651	Double C2-like domain-containing protein alpha
15	9606.ENSP00000279392	0.650	HIRA-interacting protein 3
16	9606.ENSP00000457016	0.625	INO80 complex subunit E
17	9606.ENSP00000482609	0.622	Peroxisome assembly protein 12
18	9606.ENSP00000279387	0.616	Serine/threonine-protein phosphatase 4 catalytic subunit
19	9606.ENSP00000384363	0.615	Lysophospholipase D GDPD3
20	9606.ENSP00000404860	0.609	Schwannomin interacting protein 1, isoform CRA_c

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0098772	0.998	molecular function regulator activity
GO:0038191	0.993	neuropilin binding
GO:0030234	0.865	enzyme regulator activity
GO:0019207	0.834	kinase regulator activity
GO:0140677	0.816	molecular function activator activity
GO:0019887	0.726	protein kinase regulator activity
GO:0008047	0.708	enzyme activator activity
GO:0019899	0.416	enzyme binding
GO:0019209	0.324	kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0000902	0.994	cell morphogenesis
GO:0032990	0.991	cell part morphogenesis
GO:0031175	0.986	neuron projection development
GO:0048518	0.978	positive regulation of biological process
GO:0050896	0.971	response to stimulus
GO:0048522	0.969	positive regulation of cellular process
GO:0048583	0.952	regulation of response to stimulus
GO:0023051	0.940	regulation of signaling
GO:0010646	0.940	regulation of cell communication
GO:0051716	0.938	cellular response to stimulus
GO:0048858	0.917	cell projection morphogenesis
GO:0007154	0.916	cell communication
GO:0007165	0.912	signal transduction
GO:0048812	0.910	neuron projection morphogenesis
GO:0000904	0.899	cell morphogenesis involved in differentiation
GO:0051128	0.898	regulation of cellular component organization
GO:0048667	0.868	cell morphogenesis involved in neuron differentiation
GO:0009966	0.862	regulation of signal transduction
GO:0035556	0.834	intracellular signal transduction
GO:0080135	0.796	regulation of cellular response to stress
GO:1902531	0.785	regulation of intracellular signal transduction
GO:1902533	0.760	positive regulation of intracellular signal transduction
GO:0043410	0.687	positive regulation of MAPK cascade
GO:0000165	0.662	MAPK cascade
GO:0044237	0.651	cellular metabolic process
GO:0071704	0.641	organic substance metabolic process
GO:0032872	0.640	regulation of stress-activated MAPK cascade
GO:0032874	0.589	positive regulation of stress-activated MAPK cascade
GO:0046328	0.587	regulation of JNK cascade
GO:0019222	0.538	regulation of metabolic process
GO:0044238	0.524	primary metabolic process
GO:0016358	0.495	dendrite development
GO:0006807	0.485	nitrogen compound metabolic process
GO:0080090	0.471	regulation of primary metabolic process
GO:0051171	0.471	regulation of nitrogen compound metabolic process
GO:0060255	0.470	regulation of macromolecule metabolic process
GO:0048523	0.463	negative regulation of cellular process
GO:0032970	0.451	regulation of actin filament-based process
GO:0033043	0.444	regulation of organelle organization
GO:0031323	0.438	regulation of cellular metabolic process
GO:0009893	0.403	positive regulation of metabolic process
GO:0051173	0.387	positive regulation of nitrogen compound metabolic process
GO:0010604	0.387	positive regulation of macromolecule metabolic process
GO:0046330	0.369	positive regulation of JNK cascade
GO:0043170	0.344	macromolecule metabolic process
GO:0031325	0.344	positive regulation of cellular metabolic process
GO:1901564	0.329	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0070013	0.996	intracellular organelle lumen
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0005654	0.993	nucleoplasm
GO:0032991	0.980	protein-containing complex
GO:0031982	0.927	vesicle
GO:0012505	0.667	endomembrane system
GO:0016020	0.526	membrane
GO:0005856	0.477	cytoskeleton
GO:0005886	0.413	plasma membrane
GO:0005730	0.343	nucleolus
GO:0042995	0.317	cell projection
GO:0031410	0.304	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]