StarFunc result for job id Q9UL62

User Input

>input (973 residues)
MAQLYYKKVNYSPYRDRIPLQIVRAETELSAEEKAFLNAVEKGDYATVKQALQEAEIYYN
VNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRR
PSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVE
CVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAE
YEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHSEELDPQKYHDLAKLKVAIKYHQKE
FVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFI
KKPFIKFICHTASYLTFLFMLLLASQHIVRTDLHVQGPPPTVVEWMILPWVLGFIWGEIK
EMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSRPREEWEMWHPTLIAEA
LFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYF
YYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFV
GATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPP
FNIIPSPKSFLYLGNWFNNTFCPKRDPDGRRRRRNLRSFTERNADSLIQNQHYQEVIRNL
VKRYVAAMIRNSKTHEGLTEENFKELKQDISSFRYEVLDLLGNRKHPRSFSTSSTELSQR
DDNNDGSGGARAKSKSVSFNLGCKKKTCHGPPLIRTMPRSSGAQGKSKAESSSKRSFMGP
SLKKLGLLFSKFNGHMSEPSSEPMYTISDGIVQQHCMWQDIRYSQMEKGKAEACSQSEIN
LSEVELGEVQGAAQSSECPLACSSSLHCASSICSSNSKLLDSSEDVFETWGEACDLLMHK
WGDGQEEQVTTRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QX29	0.873	0.872	0.000	975	0.969	0.967	Q9QX29.pdb.gz	TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus OX=10090 GN=Trpc5 PE=1 SV=2
2	AFDB:O35119	0.771	0.768	5.100E-83	977	0.643	0.641	O35119.pdb.gz	TRPC4_RAT Short transient receptor potential channel 4 OS=Rattus norvegicus OX=10116 GN=Trpc4 PE=1 SV=2
3	AFDB:A0A0R4IM91	0.769	0.817	9.985E-83	915	0.629	0.669	A0A0R4IM91.pdb.gz	A0A0R4IM91_DANRE Transient receptor potential cation channel, subfamily C, member 4b OS=Danio rerio OX=7955 GN=trpc4a PE=4 SV=1
4	PDB:7b0jA	0.684	0.972	6.835E-67	682	0.572	0.817	7b0jA.pdb.gz	Structural basis of TRPC4 regulation by calmodulin and pharmacological agents.
5	PDB:7b1gA	0.684	0.958	5.376E-63	691	0.565	0.796	7b1gA.pdb.gz	Structural basis of TRPC4 regulation by calmodulin and pharmacological agents.
6	PDB:6ysnA	0.612	0.977	2.295E-61	606	0.618	0.992	6ysnA.pdb.gz	Human TRPC5 structures reveal interaction of a xanthine-based TRPC1/4/5 inhibitor with a conserved lipid binding site.
7	AFDB:C0JJ14	0.656	0.830	3.528E-52	760	0.349	0.447	C0JJ14.pdb.gz	C0JJ14_PIG Short transient receptor potential channel 1 OS=Sus scrofa OX=9823 GN=TRPC1 PE=2 SV=1
8	AFDB:F1LQF7	0.659	0.741	7.672E-47	862	0.326	0.368	F1LQF7.pdb.gz	F1LQF7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=2
9	AFDB:Q9Y210	0.657	0.685	1.207E-44	931	0.320	0.334	Q9Y210.pdb.gz	TRPC6_HUMAN Short transient receptor potential channel 6 OS=Homo sapiens OX=9606 GN=TRPC6 PE=1 SV=1
10	AFDB:G1U2U3	0.668	0.656	1.440E-42	991	0.328	0.322	G1U2U3.pdb.gz	G1U2U3_RABIT Transient receptor potential cation channel subfamily C member 3 OS=Oryctolagus cuniculus OX=9986 GN=TRPC3 PE=1 SV=2
11	PDB:7dxgA	0.641	0.881	1.508E-40	698	0.301	0.420	7dxgA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.
12	PDB:6uz8A	0.637	0.834	7.324E-40	734	0.299	0.396	6uz8A.pdb.gz	Structural basis for pharmacological modulation of the TRPC6 channel.
13	PDB:7dxbA	0.633	0.827	3.420E-39	738	0.307	0.405	7dxbA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.
14	PDB:5zbgA	0.623	0.895	4.919E-36	670	0.294	0.427	5zbgA.pdb.gz
15	PDB:5yx9A	0.616	0.875	1.321E-35	675	0.297	0.428	5yx9A.pdb.gz
16	PDB:5vkqA	0.389	0.264	3.533E-16	1499	0.139	0.090	5vkqA.pdb.gz
17	PDB:6co7A	0.392	0.364	1.748E-13	1061	0.147	0.135	6co7A.pdb.gz	Structure of a TRPM2 channel in complex with Ca2+explains unique gating regulation.
18	AFDB:F4J8G7	0.154	0.094	4.861E-4	2138	0.124	0.057	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
19	AFDB:Q8UVC1	0.158	0.152	1.071E-3	1021	0.142	0.135	Q8UVC1.pdb.gz	INVS_DANRE Inversin OS=Danio rerio OX=7955 GN=invs PE=2 SV=1
20	AFDB:A1Z987	0.133	0.113	8.363E-3	1351	0.164	0.118	A1Z987.pdb.gz	A1Z987_DROME Chromosome associated protein G, isoform F OS=Drosophila melanogaster OX=7227 GN=Cap-G PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K149	1924	962	0.954	0.965	A0A0G2K149_RAT Transient receptor potential cation channel, subfamily C, member 5 OS=Rattus norvegicus OX=10116 GN=Trpc5 PE=4 SV=2
2	A0A0R4IM91	1230	915	0.617	0.656	A0A0R4IM91_DANRE Transient receptor potential cation channel, subfamily C, member 4b OS=Danio rerio OX=7955 GN=trpc4a PE=4 SV=1
3	C0JJ14	631	760	0.348	0.446	C0JJ14_PIG Short transient receptor potential channel 1 OS=Sus scrofa OX=9823 GN=TRPC1 PE=2 SV=1
4	E1U7G1	681	796	0.370	0.452	E1U7G1_DANRE Short transient receptor potential channel 1 OS=Danio rerio OX=7955 GN=trpc1 PE=2 SV=1
5	G1U2U3	555	991	0.327	0.321	G1U2U3_RABIT Transient receptor potential cation channel subfamily C member 3 OS=Oryctolagus cuniculus OX=9986 GN=TRPC3 PE=1 SV=2
6	O35119	1230	977	0.655	0.652	TRPC4_RAT Short transient receptor potential channel 4 OS=Rattus norvegicus OX=10116 GN=Trpc4 PE=1 SV=2
7	P19334	604	1275	0.351	0.268	TRP_DROME Transient receptor potential protein OS=Drosophila melanogaster OX=7227 GN=trp PE=1 SV=3
8	P48994	642	1124	0.351	0.304	TRPL_DROME Transient-receptor-potential-like protein OS=Drosophila melanogaster OX=7227 GN=trpl PE=1 SV=2
9	P48995	672	793	0.366	0.449	TRPC1_HUMAN Short transient receptor potential channel 1 OS=Homo sapiens OX=9606 GN=TRPC1 PE=1 SV=1
10	Q13507	556	921	0.328	0.346	TRPC3_HUMAN Short transient receptor potential channel 3 OS=Homo sapiens OX=9606 GN=TRPC3 PE=1 SV=4
11	Q61056	670	793	0.365	0.448	TRPC1_MOUSE Short transient receptor potential channel 1 OS=Mus musculus OX=10090 GN=Trpc1 PE=1 SV=5
12	Q8VD38	1977	974	0.974	0.973	Q8VD38_RAT Transient receptor potential cation channel subfamily C member 5 OS=Rattus norvegicus OX=10116 GN=Trpc5 PE=2 SV=1
13	Q9HCX4	549	862	0.332	0.375	TRPC7_HUMAN Short transient receptor potential channel 7 OS=Homo sapiens OX=9606 GN=TRPC7 PE=1 SV=1
14	Q9JMI9	550	909	0.325	0.348	TRPC3_RAT Short transient receptor potential channel 3 OS=Rattus norvegicus OX=10116 GN=Trpc3 PE=2 SV=4
15	Q9PRI8	671	778	0.371	0.464	Q9PRI8_XENLA Short transient receptor potential channel 1 OS=Xenopus laevis OX=8355 GN=trpc1.L PE=2 SV=1
16	Q9QUQ5	1232	974	0.654	0.653	TRPC4_MOUSE Short transient receptor potential channel 4 OS=Mus musculus OX=10090 GN=Trpc4 PE=1 SV=1
17	Q9QX01	629	759	0.349	0.448	TRPC1_RAT Short transient receptor potential channel 1 OS=Rattus norvegicus OX=10116 GN=Trpc1 PE=1 SV=1
18	Q9QX29	1968	975	0.969	0.967	TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus OX=10090 GN=Trpc5 PE=1 SV=2
19	Q9QZC1	551	910	0.325	0.347	TRPC3_MOUSE Short transient receptor potential channel 3 OS=Mus musculus OX=10090 GN=Trpc3 PE=1 SV=2
20	Q9UBN4	1242	977	0.656	0.653	TRPC4_HUMAN Short transient receptor potential channel 4 OS=Homo sapiens OX=9606 GN=TRPC4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.56	21.9	Ankyrin repeat
2	PF12796 Ank_2	1.8e-07	42.9	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.01	27.2	Ankyrin repeat
4	PF13637 Ank_4	0.0037	29.1	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3.1	19.5	Ankyrin repeats (many copies)
6	PF05823 Gp-FAR-1	4.6e+02	12.6	Nematode fatty acid retinoid binding protein (Gp-FAR-1)
7	PF00520 Ion_trans	4.6e-29	112.9	Ion transport protein
8	PF08016 PKD_channel	0.34	21.8	Polycystin cation channel
9	PF08344 TRP_2	1.4e-24	97.3	Transient receptor ion channel II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262839

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419313	0.942	Short transient receptor potential channel 1
2	9606.ENSP00000478059	0.905	Stromal interaction molecule 1
3	9606.ENSP00000369027	0.864	Short transient receptor potential channel 4
4	9606.ENSP00000385019	0.856	Voltage-dependent T-type calcium channel subunit alpha-1I
5	9606.ENSP00000352011	0.853	Voltage-dependent T-type calcium channel subunit alpha-1G
6	9606.ENSP00000429243	0.853	Stathmin-2
7	9606.ENSP00000334198	0.843	Voltage-dependent T-type calcium channel subunit alpha-1H
8	9606.ENSP00000262613	0.834	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
9	9606.ENSP00000331044	0.823	Enkurin
10	9606.ENSP00000363708	0.803	Bone morphogenetic protein receptor type-2
11	9606.ENSP00000415332	0.802	SEC14 domain and spectrin repeat-containing protein 1
12	9606.ENSP00000244007	0.777	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
13	9606.ENSP00000406191	0.773	Transient receptor potential cation channel subfamily V member 4
14	9606.ENSP00000319486	0.764	Tetraspanin-16
15	9606.ENSP00000262209	0.763	Transient receptor potential cation channel subfamily A member 1
16	9606.ENSP00000301365	0.760	Transient receptor potential cation channel subfamily V member 3
17	9606.ENSP00000368966	0.745	Short transient receptor potential channel 3
18	9606.ENSP00000340913	0.744	Short transient receptor potential channel 6
19	9606.ENSP00000342222	0.736	Transient receptor potential cation channel subfamily V member 2
20	9606.ENSP00000306253	0.725	Inositol 1,4,5-trisphosphate receptor type 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005261	1.000	monoatomic cation channel activity
GO:0005262	0.985	calcium channel activity
GO:0043167	0.981	ion binding
GO:0043168	0.969	anion binding
GO:0043178	0.968	alcohol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050789	0.975	regulation of biological process
GO:0050794	0.973	regulation of cellular process
GO:0032501	0.972	multicellular organismal process
GO:0065008	0.936	regulation of biological quality
GO:0048856	0.909	anatomical structure development
GO:0071702	0.897	organic substance transport
GO:0007275	0.896	multicellular organism development
GO:0042391	0.884	regulation of membrane potential
GO:0048731	0.880	system development
GO:0048518	0.873	positive regulation of biological process
GO:0048519	0.816	negative regulation of biological process
GO:0006811	0.806	monoatomic ion transport
GO:0051094	0.798	positive regulation of developmental process
GO:0006812	0.796	monoatomic cation transport
GO:0098662	0.782	inorganic cation transmembrane transport
GO:0098655	0.780	monoatomic cation transmembrane transport
GO:0051174	0.771	regulation of phosphorus metabolic process
GO:0008361	0.767	regulation of cell size
GO:0007399	0.765	nervous system development
GO:0051171	0.752	regulation of nitrogen compound metabolic process
GO:0048522	0.752	positive regulation of cellular process
GO:0022603	0.732	regulation of anatomical structure morphogenesis
GO:0080090	0.709	regulation of primary metabolic process
GO:0050767	0.689	regulation of neurogenesis
GO:0050770	0.655	regulation of axonogenesis
GO:0061387	0.655	regulation of extent of cell growth
GO:0030516	0.640	regulation of axon extension
GO:0019220	0.619	regulation of phosphate metabolic process
GO:0030001	0.612	metal ion transport
GO:0070588	0.603	calcium ion transmembrane transport
GO:0022008	0.598	neurogenesis
GO:0050896	0.597	response to stimulus
GO:0051130	0.578	positive regulation of cellular component organization
GO:0009893	0.395	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005886	0.992	plasma membrane
GO:0032991	0.984	protein-containing complex
GO:0005622	0.931	intracellular anatomical structure
GO:0005737	0.917	cytoplasm
GO:0043226	0.694	organelle
GO:0043227	0.675	membrane-bounded organelle
GO:0036477	0.651	somatodendritic compartment
GO:0043229	0.519	intracellular organelle
GO:0120025	0.507	plasma membrane bounded cell projection
GO:1990351	0.455	transporter complex
GO:0098796	0.438	membrane protein complex
GO:1902495	0.431	transmembrane transporter complex
GO:0043005	0.400	neuron projection
GO:0034702	0.376	ion channel complex
GO:0044297	0.374	cell body
GO:0034703	0.369	cation channel complex
GO:0097447	0.365	dendritic tree
GO:0030425	0.361	dendrite
GO:0034704	0.324	calcium channel complex
GO:0043025	0.315	neuronal cell body
GO:0098857	0.305	membrane microdomain
GO:0045121	0.304	membrane raft

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.990	Ca(2+)(in) = Ca(2+)(out)

[back to server]