StarFunc result for job id Q9UL68

User Input

>input (1186 residues)
MEVDTEEKRHRTRSKGVRVPVEPAIQELFSCPTPGCDGSGHVSGKYARHRSVYGCPLAKK
RKTQDKQPQEPAPKRKPFAVKADSSSVDECDDSDGTEDMDEKEEDEGEEYSEDNDEPGDE
DEEDEEGDREEEEEIEEEDEDDDEDGEDVEDEEEEEEEEEEEEEEEENEDHQMNCHNTRI
MQDTEKDDNNNDEYDNYDELVAKSLLNLGKIAEDAAYRARTESEMNSNTSNSLEDDSDKN
ENLGRKSELSLDLDSDVVRETVDSLKLLAQGHGVVLSENMNDRNYADSMSQQDSRNMNYV
MLGKPMNNGLMEKMVEESDEEVCLSSLECLRNQCFDLARKLSETNPQERNPQQNMNIRQH
VRPEEDFPGRTPDRNYSDMLNLMRLEEQLSPRSRVFASCAKEDGCHERDDDTTSVNSDRS
EEVFDMTKGNLTLLEKAIALETERAKAMREKMAMEAGRRDNMRSYEDQSPRQLPGEDRKP
KSSDSHVKKPYYGKDPSRTEKKESKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEI
LAMHESVLKCPTPGCTGRGHVNSNRNSHRSLSGCPIAAAEKLAKAQEKHQSCDVSKSSQA
SDRVLRPMCFVKQLEIPQYGYRNNVPTTTPRSNLAKELEKYSKTSFEYNSYDNHTYGKRA
IAPKVQTRDISPKGYDDAKRYCKDPSPSSSSTSSYAPSSSSNLSCGGGSSASSTCSKSSF
DYTHDMEAAHMAATAILNLSTRCREMPQNLSTKPQDLCATRNPDMEVDENGTLDLSMNKQ
RPRDSCCPILTPLEPMSPQQQAVMNNRCFQLGEGDCWDLPVDYTKMKPRRIDEDESKDIT
PEDLDPFQEALEERRYPGEVTIPSPKPKYPQCKESKKDLITLSGCPLADKSIRSMLATSS
QELKCPTPGCDGSGHITGNYASHRSLSGCPRAKKSGIRIAQSKEDKEDQEPIRCPVPGCD
GQGHITGKYASHRSASGCPLAAKRQKDGYLNGSQFSWKSVKTEGMSCPTPGCDGSGHVSG
SFLTHRSLSGCPRATSAMKKAKLSGEQMLTIKQRASNGIENDEEIKQLDEEIKELNESNS
QMEADMIKLRTQITTMESNLKTIEEENKVIEQQNESLLHELANLSQSLIHSLANIQLPHM
DPINEQNFDAYVTTLTEMYTNQDRYQSPENKALLENIKQAVRGIQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70475	0.118	0.118	0.000	1187	0.942	0.941	P70475.pdb.gz	MYT1L_RAT Myelin transcription factor 1-like protein OS=Rattus norvegicus OX=10116 GN=Myt1l PE=1 SV=3
2	AFDB:P20482	0.056	0.052	7.332E-4	1383	0.142	0.122	P20482.pdb.gz	CNC_DROME Segmentation protein cap'n'collar OS=Drosophila melanogaster OX=7227 GN=cnc PE=2 SV=3
3	AFDB:B9G5N1	0.071	0.094	3.020E-3	844	0.119	0.167	B9G5N1.pdb.gz	PAIR3_ORYSJ Meiosis-specific protein PAIR3 OS=Oryza sativa subsp. japonica OX=39947 GN=PAIR3 PE=2 SV=1
4	AFDB:P59759	0.047	0.051	5.589E-3	1080	0.124	0.136	P59759.pdb.gz	MRTFB_MOUSE Myocardin-related transcription factor B OS=Mus musculus OX=10090 GN=Mrtfb PE=1 SV=1
5	AFDB:Q13029	0.044	0.035	9.145E-3	1718	0.125	0.086	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
6	AFDB:A0MWC1	0.052	0.056	1.244E-2	1091	0.113	0.123	A0MWC1.pdb.gz	A0MWC1_DANRE Sal-like protein 4 OS=Danio rerio OX=7955 GN=sb:cb372 PE=1 SV=1
7	AFDB:O08934	0.036	0.062	2.302E-2	530	0.077	0.172	O08934.pdb.gz	UNC4_MOUSE Homeobox protein unc-4 homolog OS=Mus musculus OX=10090 GN=Uncx PE=2 SV=2
8	AFDB:Q9HC77	0.057	0.052	2.448E-2	1338	0.133	0.118	Q9HC77.pdb.gz	CENPJ_HUMAN Centromere protein J OS=Homo sapiens OX=9606 GN=CENPJ PE=1 SV=2
9	AFDB:Q7SZL5	0.066	0.059	3.132E-2	1338	0.135	0.120	Q7SZL5.pdb.gz	MTUS1_XENLA Microtubule-associated tumor suppressor 1 homolog OS=Xenopus laevis OX=8355 GN=mtus1 PE=1 SV=1
10	AFDB:Q9UJQ4	0.059	0.064	3.767E-2	1053	0.107	0.121	Q9UJQ4.pdb.gz	SALL4_HUMAN Sal-like protein 4 OS=Homo sapiens OX=9606 GN=SALL4 PE=1 SV=1
11	PDB:7wooI	0.074	0.346	1.849	187	0.019	0.118	7wooI.pdb.gz
12	PDB:6htsR	0.026	0.199	3.421	72	0.014	0.236	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
13	PDB:4kxrA	0.027	0.251	5.598	85	0.006	0.082	4kxrA.pdb.gz
14	PDB:7sqkH	0.055	0.221	5.953	201	0.017	0.100	7sqkH.pdb.gz
15	PDB:7pd3q	0.062	0.260	6.733	198	0.026	0.157	7pd3q.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
16	PDB:7r5jW0	0.036	0.054	6.733	735	0.028	0.045	7r5jW0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
17	PDB:5mekA	0.024	0.067	7.160	322	0.009	0.034	5mekA.pdb.gz	Structural and biochemical studies of sulphotransferase 18 from Arabidopsis thaliana explain its substrate specificity and reaction mechanism.
18	PDB:6uxvG	0.064	0.268	8.098	197	0.024	0.147	6uxvG.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
19	PDB:7kuyE	0.034	0.094	8.098	338	0.006	0.021	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
20	PDB:4dohA	0.035	0.169	9.159	153	0.010	0.078	4dohA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60284	0.0	765	1047	0.358	0.405	ST18_HUMAN Suppression of tumorigenicity 18 protein OS=Homo sapiens OX=9606 GN=ST18 PE=1 SV=1
2	P70475	0.0	1913	1187	0.819	0.818	MYT1L_RAT Myelin transcription factor 1-like protein OS=Rattus norvegicus OX=10116 GN=Myt1l PE=1 SV=3
3	P97500	0.0	1930	1187	0.822	0.821	MYT1L_MOUSE Myelin transcription factor 1-like protein OS=Mus musculus OX=10090 GN=Myt1l PE=1 SV=3
4	Q01538	0.0	878	1121	0.407	0.431	MYT1_HUMAN Myelin transcription factor 1 OS=Homo sapiens OX=9606 GN=MYT1 PE=1 SV=2
5	Q8CFC2	0.0	880	1127	0.405	0.426	MYT1_MOUSE Myelin transcription factor 1 OS=Mus musculus OX=10090 GN=Myt1 PE=1 SV=1
6	Q9QX27	0.0	761	1032	0.356	0.409	ST18_RAT Suppression of tumorigenicity 18 protein OS=Rattus norvegicus OX=10116 GN=St18 PE=2 SV=2
7	O02274	3.89e-28	122	539	0.050	0.109	ZTF11_CAEEL Zinc finger protein ztf-11 OS=Caenorhabditis elegans OX=6239 GN=ztf-11 PE=1 SV=3
8	Q9Y468	1.62e-08	61.6	840	0.027	0.038	LMBL1_HUMAN Lethal(3)malignant brain tumor-like protein 1 OS=Homo sapiens OX=9606 GN=L3MBTL1 PE=1 SV=4
9	E7EUP3	9.51e-05	48.9	425	0.014	0.040	E7EUP3_HUMAN histone acetyltransferase OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1
10	O95251	9.69e-05	48.9	611	0.014	0.028	KAT7_HUMAN Histone acetyltransferase KAT7 OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1
11	Q5SVQ0	1.02e-04	48.9	613	0.014	0.028	KAT7_MOUSE Histone acetyltransferase KAT7 OS=Mus musculus OX=10090 GN=Kat7 PE=1 SV=1
12	Q7ZW29	2.18e-04	47.8	568	0.013	0.028	Q7ZW29_DANRE histone acetyltransferase OS=Danio rerio OX=7955 GN=myst2 PE=1 SV=1
13	Q12019	0.13	39.3	4910	0.028	0.007	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
14	O94248	0.43	37.4	4717	0.034	0.008	MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mdn1 PE=1 SV=1
15	Q8I3A0	0.62	37.0	2568	0.024	0.011	Q8I3A0_PLAF7 Copper-transporting ATPase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0904900 PE=4 SV=2
16	Q7K734	6.1	33.5	672	0.024	0.043	FEN1_PLAF7 Flap endonuclease 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=FEN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04977 DivIC	2.2e+02	13.0	Septum formation initiator
2	PF07889 DUF1664	96	14.4	Protein of unknown function (DUF1664)
3	PF08474 MYT1	7.1e-114	391.3	Myelin transcription factor 1
4	PF01530 zf-C2HC	1.9e-82	282.3	Zinc finger, C2HC type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000396103

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000329170	0.898	POU domain, class 3, transcription factor 2
2	9606.ENSP00000266744	0.890	Achaete-scute homolog 1
3	9606.ENSP00000295108	0.815	Neurogenic differentiation factor 1
4	9606.ENSP00000355001	0.794	POU domain, class 3, transcription factor 3
5	9606.ENSP00000306754	0.780	Neurogenic differentiation factor 2
6	9606.ENSP00000252804	0.715	Peroxidasin homolog
7	9606.ENSP00000347451	0.713	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1
8	9606.ENSP00000317333	0.689	Neurogenin-2
9	9606.ENSP00000340226	0.655	LIM homeobox transcription factor 1-alpha
10	9606.ENSP00000368278	0.630	Interleukin-1 receptor accessory protein-like 1
11	9606.ENSP00000366347	0.626	Homeobox protein Nkx-2.2
12	9606.ENSP00000315112	0.623	E3 ubiquitin-protein ligase RNF31
13	9606.ENSP00000309117	0.615	RNA binding protein fox-1 homolog 1
14	9606.ENSP00000379880	0.611	Leucine-rich repeat-containing protein 3B
15	9606.ENSP00000396421	0.604	NXPE family member 3
16	9606.ENSP00000380746	0.603	F-box/LRR-repeat protein 16
17	9606.ENSP00000463653	0.603	RNA binding protein fox-1 homolog 3
18	9606.ENSP00000323588	0.594	Transcription factor SOX-2
19	9606.ENSP00000320318	0.586	Sialidase-4
20	9606.ENSP00000355718	0.586	Delta-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.995	cis-regulatory region sequence-specific DNA binding
GO:0001228	0.971	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.968	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0005515	0.953	protein binding
GO:0050897	0.890	cobalt ion binding
GO:0008270	0.886	zinc ion binding
GO:0003712	0.881	transcription coregulator activity
GO:0003713	0.861	transcription coactivator activity
GO:0044323	0.634	retinoic acid-responsive element binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0080090	0.978	regulation of primary metabolic process
GO:0051171	0.978	regulation of nitrogen compound metabolic process
GO:0031323	0.978	regulation of cellular metabolic process
GO:0010468	0.978	regulation of gene expression
GO:0006355	0.968	regulation of DNA-templated transcription
GO:0009987	0.903	cellular process
GO:0032502	0.849	developmental process
GO:0006357	0.816	regulation of transcription by RNA polymerase II
GO:0048856	0.777	anatomical structure development
GO:0032501	0.730	multicellular organismal process
GO:0048518	0.690	positive regulation of biological process
GO:0048522	0.625	positive regulation of cellular process
GO:0007275	0.575	multicellular organism development
GO:0048731	0.495	system development
GO:0009893	0.458	positive regulation of metabolic process
GO:0010604	0.441	positive regulation of macromolecule metabolic process
GO:0031325	0.424	positive regulation of cellular metabolic process
GO:0007399	0.412	nervous system development
GO:0051173	0.396	positive regulation of nitrogen compound metabolic process
GO:0045893	0.377	positive regulation of DNA-templated transcription
GO:0030154	0.321	cell differentiation
GO:0048519	0.314	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]