StarFunc result for job id Q9ULB1

User Input

>input (1477 residues)
MGTALLQRGGCFLLCLSLLLLGCWAELGSGLEFPGAEGQWTRFPKWNACCESEMSFQLKT
RSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIR
RQFRNTTLFIDQVEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPF
KGWIRDVRVNSSQVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQ
AVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNP
IQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNG
KFNDNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSP
STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLD
PITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDF
FAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTA
PGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMA
EVQSTAGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLS
YDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTV
NLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHT
RLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFR
NIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKG
YLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNL
DLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGC
EGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWP
PNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAI
EESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQG
QPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTS
IMETTTTLATSTARRGKPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTR
AGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESRN
YISNSAQSNGAVVKEKQPSSAKSSNKNKKNKDKEYYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1XQX0	0.756	0.750	0.000	1491	0.775	0.768	A1XQX0.pdb.gz	NR1AA_DANRE Neurexin-1a OS=Danio rerio OX=7955 GN=nrxn1a PE=2 SV=1
2	AFDB:B9VMQ3	0.364	0.437	0.000	1210	0.289	0.353	B9VMQ3.pdb.gz
3	AFDB:Q28146	0.825	0.798	0.000	1530	0.989	0.955	Q28146.pdb.gz	NRX1A_BOVIN Neurexin-1 OS=Bos taurus OX=9913 GN=NRXN1 PE=1 SV=1
4	AFDB:Q9P2S2	0.695	0.602	0.000	1712	0.687	0.593	Q9P2S2.pdb.gz	NRX2A_HUMAN Neurexin-2 OS=Homo sapiens OX=9606 GN=NRXN2 PE=2 SV=1
5	AFDB:Q9ULB1	1.000	1.000	0.000	1477	1.000	1.000	Q9ULB1.pdb.gz	NRX1A_HUMAN Neurexin-1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
6	AFDB:Q9Y4C0	0.683	0.614	0.000	1643	0.701	0.630	Q9Y4C0.pdb.gz	NRX3A_HUMAN Neurexin-3 OS=Homo sapiens OX=9606 GN=NRXN3 PE=1 SV=4
7	AFDB:Q9CPW0	0.156	0.171	8.036E-61	1332	0.193	0.214	Q9CPW0.pdb.gz	CNTP2_MOUSE Contactin-associated protein-like 2 OS=Mus musculus OX=10090 GN=Cntnap2 PE=1 SV=2
8	AFDB:E9PY62	0.159	0.179	5.177E-60	1287	0.186	0.214	E9PY62.pdb.gz	E9PY62_MOUSE Contactin associated protein-like 3 OS=Mus musculus OX=10090 GN=Cntnap3 PE=1 SV=1
9	AFDB:A1ZA87	0.109	0.118	1.679E-28	1361	0.134	0.145	A1ZA87.pdb.gz	A1ZA87_DROME SP2353, isoform A OS=Drosophila melanogaster OX=7227 GN=SP2353 PE=4 SV=1
10	AFDB:B0S8G4	0.078	0.071	5.406E-6	1645	0.034	0.030	B0S8G4.pdb.gz
11	PDB:5hxbY	0.066	0.078	1.690E-5	1080	0.080	0.109	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
12	PDB:4pbpB	0.098	0.591	2.477E-5	210	0.019	0.133	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
13	PDB:3v0aB	0.081	0.103	2.598E-5	1150	0.030	0.039	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
14	PDB:2a3wA	0.094	0.567	2.998E-5	204	0.021	0.152	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
15	PDB:3ffzA	0.081	0.093	6.138E-5	1246	0.030	0.035	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
16	PDB:7zl1A	0.102	0.592	8.176E-5	215	0.022	0.153	7zl1A.pdb.gz
17	PDB:7u9tA	0.082	0.040	1.450E-4	4229	0.079	0.027	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
18	PDB:1b09A	0.093	0.565	1.756E-4	206	0.018	0.131	1b09A.pdb.gz	The physiological structure of human C-reactive protein and its complex with phosphocholine.
19	PDB:6m5yA	0.070	0.300	1.842E-4	270	0.025	0.137	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
20	PDB:4eqvA	0.068	0.163	1.932E-4	509	0.030	0.086	4eqvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KGL0	851	1847	0.345	0.276	A0A0B4KGL0_DROME Neurexin 1, isoform F OS=Drosophila melanogaster OX=7227 GN=Nrx-1 PE=4 SV=1
2	A0A0B4KGQ3	848	1825	0.332	0.269	A0A0B4KGQ3_DROME Neurexin 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Nrx-1 PE=4 SV=1
3	A0A0B4KH61	847	1525	0.333	0.323	A0A0B4KH61_DROME Neurexin 1, isoform G OS=Drosophila melanogaster OX=7227 GN=Nrx-1 PE=4 SV=1
4	A0A0R4J2G7	3016	1495	0.992	0.980	A0A0R4J2G7_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
5	A0A1D5RMU6	3030	1499	0.995	0.980	A0A1D5RMU6_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
6	A1XQX0	2339	1491	0.781	0.774	NR1AA_DANRE Neurexin-1a OS=Danio rerio OX=7955 GN=nrxn1a PE=2 SV=1
7	A1XQX4	1798	1670	0.596	0.528	A1XQX4_DANRE Neurexin 2a alpha OS=Danio rerio OX=7955 GN=nrxn2a PE=2 SV=1
8	D0PRN2	600	466	0.228	0.723	NRX1B_CHICK Neurexin-1-beta OS=Gallus gallus OX=9031 GN=NRXN1 PE=1 SV=1
9	E7ERL8	3055	1507	1.000	0.980	E7ERL8_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
10	E9Q7X7	1874	1710	0.632	0.546	NRX2A_MOUSE Neurexin-2 OS=Mus musculus OX=10090 GN=Nrxn2 PE=1 SV=1
11	P0DI97	706	468	0.239	0.754	NRX1B_MOUSE Neurexin-1-beta OS=Mus musculus OX=10090 GN=Nrxn1 PE=1 SV=1
12	P58400	708	472	0.240	0.752	NRX1B_HUMAN Neurexin-1-beta OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=3
13	Q28142	655	467	0.238	0.752	NRX1B_BOVIN Neurexin-1-beta OS=Bos taurus OX=9913 GN=NRXN1 PE=1 SV=2
14	Q28146	3017	1530	0.993	0.958	NRX1A_BOVIN Neurexin-1 OS=Bos taurus OX=9913 GN=NRXN1 PE=1 SV=1
15	Q3KN41	850	1840	0.333	0.267	NRX1_DROME Neurexin 1 OS=Drosophila melanogaster OX=7227 GN=Nrx-1 PE=1 SV=1
16	Q63372	3008	1530	0.988	0.954	NRX1A_RAT Neurexin-1 OS=Rattus norvegicus OX=10116 GN=Nrxn1 PE=1 SV=3
17	Q63373	706	468	0.239	0.754	NRX1B_RAT Neurexin-1-beta OS=Rattus norvegicus OX=10116 GN=Nrxn1 PE=1 SV=1
18	Q6P9K9	1898	1571	0.646	0.607	NRX3A_MOUSE Neurexin-3 OS=Mus musculus OX=10090 GN=Nrxn3 PE=1 SV=2
19	Q9CS84	3030	1514	0.993	0.968	NRX1A_MOUSE Neurexin-1 OS=Mus musculus OX=10090 GN=Nrxn1 PE=1 SV=3
20	Q9P2S2	1870	1712	0.632	0.546	NRX2A_HUMAN Neurexin-2 OS=Homo sapiens OX=9606 GN=NRXN2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06439 3keto-disac_hyd	53	15.4	3-keto-disaccharide hydrolase
2	PF02656 DUF202	2.6e+02	13.5	Domain of unknown function (DUF202)
3	PF00008 EGF	2.4e-08	45.4	EGF-like domain
4	PF12661 hEGF	2.9	19.9	Human growth factor-like EGF
5	PF00054 Laminin_G_1	4.2e-102	349.0	Laminin G domain
6	PF02210 Laminin_G_2	2.6e-159	533.9	Laminin G domain
7	PF13385 Laminin_G_3	4e-20	83.9	Concanavalin A-like lectin/glucanases superfamily
8	PF01034 Syndecan	0.015	26.5	Syndecan domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_003922792.1

Rank	PPI partner	STRING score	Description
1	27679.XP_010334136.1	0.969	Neuroligin-1 isoform X1
2	27679.XP_010338298.1	0.952	Neuroligin-2
3	27679.XP_003943137.1	0.951	Neuroligin-3 isoform X2
4	27679.XP_010334450.1	0.951	Neuroligin-4, X-linked
5	27679.XP_003921299.1	0.920	May be signaling molecules that resemble neuropeptides.
6	27679.XP_003933981.1	0.860	Leucine-rich repeat transmembrane neuronal protein 2
7	27679.XP_010333218.1	0.857	Belongs to the MAGUK family.
8	27679.XP_003937711.1	0.813	Neurexin-2-beta isoform X1
9	27679.XP_010333627.1	0.810	Neurexin 3 isoform X1
10	27679.XP_003941210.1	0.782	SH3 and multiple ankyrin repeat domains protein 2
11	27679.XP_010341872.1	0.779	SH3 and multiple ankyrin repeat domains protein 3
12	27679.XP_003922593.1	0.771	Leucine-rich repeat transmembrane neuronal protein 1
13	27679.XP_010338060.1	0.770	Disks large homolog 4 isoform X1
14	27679.XP_003937338.2	0.757	Cerebellin-1
15	27679.XP_010349556.1	0.752	Amyloid beta A4 precursor protein-binding family A member 2
16	27679.XP_003931302.1	0.737	May be signaling molecules that resemble neuropeptides.
17	27679.XP_003936708.1	0.730	Dystroglycan
18	27679.XP_010328745.1	0.729	May be signaling molecules that resemble neuropeptides.
19	27679.XP_003928735.1	0.727	Leucine-rich repeat transmembrane neuronal protein 3
20	27679.XP_010349495.1	0.717	SH3 and multiple ankyrin repeat domains protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0038023	0.998	signaling receptor activity
GO:0098772	0.992	molecular function regulator activity
GO:0099106	0.975	ion channel regulator activity
GO:0005246	0.970	calcium channel regulator activity
GO:0050839	0.892	cell adhesion molecule binding
GO:0043167	0.476	ion binding
GO:0097109	0.415	neuroligin family protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016043	0.988	cellular component organization
GO:0048731	0.983	system development
GO:0050896	0.971	response to stimulus
GO:0007399	0.962	nervous system development
GO:0050794	0.948	regulation of cellular process
GO:0023052	0.946	signaling
GO:0007154	0.942	cell communication
GO:0046903	0.941	secretion
GO:0007612	0.939	learning
GO:0099173	0.933	postsynapse organization
GO:0007268	0.929	chemical synaptic transmission
GO:0140352	0.915	export from cell
GO:0034329	0.914	cell junction assembly
GO:1902414	0.907	protein localization to cell junction
GO:0032940	0.904	secretion by cell
GO:0035418	0.900	protein localization to synapse
GO:0007416	0.897	synapse assembly
GO:0040011	0.892	locomotion
GO:0051703	0.890	biological process involved in intraspecies interaction between organisms
GO:0072657	0.880	protein localization to membrane
GO:0050804	0.871	modulation of chemical synaptic transmission
GO:0098609	0.864	cell-cell adhesion
GO:0099054	0.862	presynapse assembly
GO:0009653	0.848	anatomical structure morphogenesis
GO:0007269	0.847	neurotransmitter secretion
GO:0030154	0.846	cell differentiation
GO:0031175	0.843	neuron projection development
GO:0032989	0.835	cellular component morphogenesis
GO:0048858	0.831	cell projection morphogenesis
GO:0048812	0.822	neuron projection morphogenesis
GO:0030534	0.804	adult behavior
GO:0042221	0.783	response to chemical
GO:0048518	0.780	positive regulation of biological process
GO:0009605	0.756	response to external stimulus
GO:0035176	0.694	social behavior
GO:0048522	0.673	positive regulation of cellular process
GO:0051239	0.668	regulation of multicellular organismal process
GO:0048667	0.583	cell morphogenesis involved in neuron differentiation
GO:0051128	0.557	regulation of cellular component organization
GO:0006996	0.481	organelle organization
GO:0061564	0.478	axon development
GO:0009628	0.477	response to abiotic stimulus
GO:0051960	0.450	regulation of nervous system development
GO:0007409	0.442	axonogenesis
GO:0042330	0.422	taxis
GO:0022406	0.414	membrane docking
GO:0007411	0.405	axon guidance
GO:0016192	0.398	vesicle-mediated transport
GO:0009612	0.396	response to mechanical stimulus
GO:0051130	0.396	positive regulation of cellular component organization
GO:0032879	0.391	regulation of localization
GO:0051240	0.385	positive regulation of multicellular organismal process
GO:0051962	0.378	positive regulation of nervous system development
GO:0061024	0.334	membrane organization
GO:0044057	0.334	regulation of system process
GO:0051716	0.324	cellular response to stimulus
GO:0050807	0.319	regulation of synapse organization
GO:0048583	0.310	regulation of response to stimulus
GO:0007165	0.301	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043229	0.994	intracellular organelle
GO:0043227	0.993	membrane-bounded organelle
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0030054	0.971	cell junction
GO:0043228	0.963	non-membrane-bounded organelle
GO:0043232	0.954	intracellular non-membrane-bounded organelle
GO:0005634	0.948	nucleus
GO:0031974	0.944	membrane-enclosed lumen
GO:0031981	0.929	nuclear lumen
GO:0045202	0.898	synapse
GO:0005730	0.884	nucleolus
GO:0036477	0.438	somatodendritic compartment
GO:0120025	0.421	plasma membrane bounded cell projection
GO:0043005	0.400	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]