StarFunc result for job id Q9ULD0

User Input

>input (1010 residues)
MSQLRLLPSRLGVQAARLLAAHDVPVFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWL
ENPQSVHKSWDSFFREASEEAFSGSAQPRPPSVVHESRSAVSSRTKTSKLVEDHLAVQSL
IRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAFYDLQEADLDKEFQLPTTTF
IGGSENTLSLREIIRRLENTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSSEEKRT
LLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRG
RLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRNITLSLVAN
PSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYT
TNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEW
RNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTLQ
EFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPATGIPEDM
LTHIGSVASSVPLEDFKIHTGLSRILRGRADMTKNRTVDWALAEYMAFGSLLKEGIHVRL
SGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYA
MASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSA
RPERFLQMSNDDSDAYPAFTKDFEVSQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKPL
IIFTPKSLLRHPEAKSSFDQMVSGTSFQRVIPEDGAAARAPEQVQRLIFCTGKVYYDLVK
ERSSQDLEEKVAITRLEQISPFPFDLIKQEAEKYPGAELAWCQEEHKNMGYYDYISPRFM
TILRRARPIWYVGRDPAAAPATGNRNTHLVSLKKFLDTAFNLQAFEGKTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IP01	0.891	0.880	0.000	1022	0.762	0.753	A0A0R4IP01.pdb.gz	A0A0R4IP01_DANRE oxoglutarate dehydrogenase (succinyl-transferring) OS=Danio rerio OX=7955 GN=im:7045267 PE=1 SV=1
2	AFDB:A0A2R8Q9W1	0.865	0.890	0.000	981	0.733	0.754	A0A2R8Q9W1.pdb.gz
3	AFDB:D3ZQD3	0.978	0.978	0.000	1010	0.924	0.924	D3ZQD3.pdb.gz	OGDHL_RAT 2-oxoglutarate dehydrogenase-like, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ogdhl PE=1 SV=2
4	AFDB:E7EZ05	0.899	0.887	0.000	1023	0.768	0.759	E7EZ05.pdb.gz	E7EZ05_DANRE oxoglutarate dehydrogenase (succinyl-transferring) OS=Danio rerio OX=7955 GN=ogdhb PE=1 SV=1
5	AFDB:E9PCR7	0.902	0.878	0.000	1038	0.761	0.741	E9PCR7.pdb.gz	E9PCR7_HUMAN oxoglutarate dehydrogenase (succinyl-transferring) OS=Homo sapiens OX=9606 GN=OGDH PE=1 SV=1
6	AFDB:E9PFG7	0.762	0.881	0.000	873	0.646	0.747	E9PFG7.pdb.gz	E9PFG7_HUMAN oxoglutarate dehydrogenase (succinyl-transferring) OS=Homo sapiens OX=9606 GN=OGDH PE=1 SV=1
7	AFDB:O61199	0.891	0.875	0.000	1029	0.553	0.543	O61199.pdb.gz	ODO1_CAEEL 2-oxoglutarate dehydrogenase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ogdh-1 PE=1 SV=2
8	AFDB:O74378	0.869	0.870	0.000	1009	0.457	0.458	O74378.pdb.gz	ODO1_SCHPO 2-oxoglutarate dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kgd1 PE=3 SV=1
9	AFDB:F4IWV2	0.845	0.840	3.483E-104	1017	0.478	0.475	F4IWV2.pdb.gz	F4IWV2_ARATH oxoglutarate dehydrogenase (succinyl-transferring) OS=Arabidopsis thaliana OX=3702 GN=At3g55410 PE=1 SV=1
10	AFDB:Q9FLH2	0.846	0.834	3.577E-103	1025	0.480	0.473	Q9FLH2.pdb.gz	Q9FLH2_ARATH oxoglutarate dehydrogenase (succinyl-transferring) OS=Arabidopsis thaliana OX=3702 GN=MPA24.10 PE=1 SV=1
11	PDB:6u3jA	0.807	0.927	2.839E-82	876	0.342	0.394	6u3jA.pdb.gz	Inhibition and Crystal Structure of the Human DHTKD1-Thiamin Diphosphate Complex.
12	PDB:2jgdA	0.740	0.916	3.656E-71	812	0.341	0.424	2jgdA.pdb.gz	Crystal Structure of the E1 Component of the Escherichia Coli 2-Oxoglutarate Dehydrogenase Multienzyme Complex.
13	PDB:6vefA	0.774	0.923	4.927E-67	844	0.358	0.429	6vefA.pdb.gz	Cryo-EM Structure of Escherichia coli 2-oxoglutarate dehydrogenase E1 component sucA
14	PDB:1itzA	0.421	0.607	2.582E-14	666	0.099	0.150	1itzA.pdb.gz	Structure and properties of an engineered transketolase from maize
15	PDB:6rjbB	0.401	0.616	3.499E-13	622	0.095	0.154	6rjbB.pdb.gz	Low-barrier hydrogen bonds in enzyme cooperativity.
16	PDB:1ay0A	0.413	0.584	4.674E-13	678	0.088	0.131	1ay0A.pdb.gz	Identification of catalytically important residues in yeast transketolase.
17	PDB:5hhtB	0.366	0.515	7.948E-13	667	0.097	0.147	5hhtB.pdb.gz	Structural Analysis of an Evolved Transketolase Reveals Divergent Binding Modes.
18	PDB:3rimA	0.396	0.548	2.221E-11	694	0.081	0.118	3rimA.pdb.gz	Structure and function of the transketolase from Mycobacterium tuberculosis and comparison with the human enzyme.
19	PDB:1umbA	0.256	0.658	1.041E-10	362	0.061	0.171	1umbA.pdb.gz	Ligand-induced Conformational Changes and a Reaction Intermediate in Branched-chain 2-Oxo Acid Dehydrogenase (E1) from Thermus thermophilus HB8, as Revealed by X-ray Crystallography
20	PDB:3exeA	0.250	0.628	1.092E-10	363	0.047	0.129	3exeA.pdb.gz	Structural basis for inactivation of the human pyruvate dehydrogenase complex by phosphorylation: role of disordered phosphorylation loops.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IP01	1656	1022	0.758	0.750	A0A0R4IP01_DANRE oxoglutarate dehydrogenase (succinyl-transferring) OS=Danio rerio OX=7955 GN=im:7045267 PE=1 SV=1
2	A0A140VJQ5	561	427	0.270	0.639	A0A140VJQ5_HUMAN Testicular tissue protein Li 131 OS=Homo sapiens OX=9606 PE=2 SV=1
3	A2ATU0	599	921	0.357	0.392	DHTK1_MOUSE 2-oxoadipate dehydrogenase complex component E1 OS=Mus musculus OX=10090 GN=Dhtkd1 PE=1 SV=1
4	B8JI08	1660	1022	0.760	0.751	B8JI08_DANRE oxoglutarate dehydrogenase (succinyl-transferring) OS=Danio rerio OX=7955 GN=im:7045267 PE=1 SV=1
5	D3ZQD3	1971	1010	0.925	0.925	OGDHL_RAT 2-oxoglutarate dehydrogenase-like, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ogdhl PE=1 SV=2
6	E7EZ05	1653	1023	0.774	0.764	E7EZ05_DANRE oxoglutarate dehydrogenase (succinyl-transferring) OS=Danio rerio OX=7955 GN=ogdhb PE=1 SV=1
7	E9PCR7	1645	1038	0.760	0.740	E9PCR7_HUMAN oxoglutarate dehydrogenase (succinyl-transferring) OS=Homo sapiens OX=9606 GN=OGDH PE=1 SV=1
8	E9PDF2	1615	1034	0.746	0.728	E9PDF2_HUMAN oxoglutarate dehydrogenase (succinyl-transferring) OS=Homo sapiens OX=9606 GN=OGDH PE=1 SV=1
9	E9PFG7	1355	873	0.615	0.711	E9PFG7_HUMAN oxoglutarate dehydrogenase (succinyl-transferring) OS=Homo sapiens OX=9606 GN=OGDH PE=1 SV=1
10	F1Q5B8	1619	1019	0.745	0.738	F1Q5B8_DANRE oxoglutarate dehydrogenase (succinyl-transferring) OS=Danio rerio OX=7955 GN=im:7045267 PE=1 SV=3
11	F4IWV2	930	1017	0.485	0.482	F4IWV2_ARATH oxoglutarate dehydrogenase (succinyl-transferring) OS=Arabidopsis thaliana OX=3702 GN=At3g55410 PE=1 SV=1
12	O61199	1170	1029	0.550	0.539	ODO1_CAEEL 2-oxoglutarate dehydrogenase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ogdh-1 PE=1 SV=2
13	O74378	880	1009	0.453	0.454	ODO1_SCHPO 2-oxoglutarate dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kgd1 PE=3 SV=1
14	P0AFG3	647	933	0.381	0.413	ODO1_ECOLI 2-oxoglutarate dehydrogenase E1 component OS=Escherichia coli (strain K12) OX=83333 GN=sucA PE=1 SV=1
15	P20967	842	1014	0.449	0.447	ODO1_YEAST 2-oxoglutarate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KGD1 PE=1 SV=2
16	P9WIS5	644	1231	0.367	0.301	KGD_MYCTU Multifunctional 2-oxoglutarate metabolism enzyme OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=kgd PE=1 SV=1
17	Q02218	1654	1023	0.760	0.751	ODO1_HUMAN 2-oxoglutarate dehydrogenase complex component E1 OS=Homo sapiens OX=9606 GN=OGDH PE=1 SV=3
18	Q383T1	684	1005	0.396	0.398	Q383T1_TRYB2 oxoglutarate dehydrogenase (succinyl-transferring) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1740 PE=3 SV=1
19	Q387A7	595	1008	0.362	0.363	Q387A7_TRYB2 2-oxoglutarate dehydrogenase subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.47.0004 PE=3 SV=1
20	Q54VG0	661	900	0.361	0.406	DHTK1_DICDI Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1 homolog, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=odhA PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16078 2-oxogl_dehyd_N	3.1e-12	57.1	2-oxoglutarate dehydrogenase N-terminus
2	PF00676 E1_dh	2.7e-83	291.0	Dehydrogenase E1 component
3	PF18308 GGA_N-GAT	1.4e+02	13.6	N-terminal extension of GAT domain
4	PF16870 OxoGdeHyase_C	2.8e-48	175.0	2-oxoglutarate dehydrogenase C-terminal
5	PF02779 Transket_pyr	2.4e-65	231.0	Transketolase, pyrimidine binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363216

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335304	0.999	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
2	9606.ENSP00000205402	0.990	Dihydrolipoyl dehydrogenase, mitochondrial
3	9606.ENSP00000299518	0.980	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
4	9606.ENSP00000217901	0.972	Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
5	9606.ENSP00000370223	0.972	Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
6	9606.ENSP00000331897	0.960	Isocitrate dehydrogenase [NADP], mitochondrial
7	9606.ENSP00000390265	0.955	Isocitrate dehydrogenase 1, cytosolic
8	9606.ENSP00000327589	0.944	Glutamate dehydrogenase 2, mitochondrial
9	9606.ENSP00000277865	0.934	Glutamate dehydrogenase 1, mitochondrial
10	9606.ENSP00000355518	0.924	Fumarate hydratase, mitochondrial
11	9606.ENSP00000377446	0.916	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
12	9606.ENSP00000367923	0.904	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
13	9606.ENSP00000359539	0.888	Aspartate aminotransferase, cytoplasmic
14	9606.ENSP00000216254	0.876	Aconitate hydratase, mitochondrial
15	9606.ENSP00000245206	0.860	Aspartate aminotransferase, mitochondrial
16	9606.ENSP00000342056	0.859	Citrate synthase, mitochondrial
17	9606.ENSP00000280346	0.849	Dihydrolipoamide S-acetyltransferase
18	9606.ENSP00000264932	0.842	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
19	9606.ENSP00000345282	0.838	Alanine aminotransferase 2
20	9606.ENSP00000364649	0.837	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.992	catalytic activity
GO:0016903	0.983	oxidoreductase activity, acting on the aldehyde or oxo group of donors
GO:0016624	0.917	oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor
GO:0043167	0.810	ion binding
GO:0004591	0.794	oxoglutarate dehydrogenase (succinyl-transferring) activity
GO:0043169	0.748	cation binding
GO:1901363	0.411	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.972	cellular process
GO:0044237	0.928	cellular metabolic process
GO:0071704	0.913	organic substance metabolic process
GO:0044238	0.861	primary metabolic process
GO:0044281	0.818	small molecule metabolic process
GO:0006091	0.495	generation of precursor metabolites and energy
GO:0006082	0.478	organic acid metabolic process
GO:0019752	0.468	carboxylic acid metabolic process
GO:0006807	0.458	nitrogen compound metabolic process
GO:0032501	0.381	multicellular organismal process
GO:1901564	0.368	organonitrogen compound metabolic process
GO:0015980	0.363	energy derivation by oxidation of organic compounds
GO:0009060	0.350	aerobic respiration
GO:0043648	0.302	dicarboxylic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.996	intracellular organelle lumen
GO:0005759	0.906	mitochondrial matrix
GO:0032991	0.415	protein-containing complex
GO:1990204	0.315	oxidoreductase complex
GO:0031981	0.305	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.2.-.-	0.983	Acting on the aldehyde or oxo group of donors.
EC:1.2.4.-	0.917	With a disulfide as acceptor.
RHEA:12188	0.794	(R)-N(6)-lipoyl-L-lysyl-[dihydrolipoyllysine-residue succinyltransferase] + 2-oxoglutarate + H(+) = (R)-N(6)-(S(8)-succinyldihydrolipoyl)-L-lysyl-[dihydrolipoyllysine-residue succinyltransferase] + CO2
EC:1.2.4.2	0.794	oxoglutarate dehydrogenase (succinyl-transferring).

[back to server]