StarFunc result for job id Q9ULD2

User Input

>input (1270 residues)
MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDYET
DPAVVTGENISLSLQGVEVFGHEKSSSDFISKQVLDMHKDSICQCPALVGTEKPKYLQHS
CHSLEAVEGQSVEPSLPFVWKPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGK
SQSFHTAGSLPPTGRRSGSTSSLSYSTWTSSHSDKTHARETTYDRESFENPQVTPSEAQD
MTYTAFSDVVMQSEVFVSDIGNQCACSSGKVTSEYTDGSQQRLVGEKETQALTPVSDGME
VPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSYCLIDDECPLMVPAFDKS
EAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVI
STDKTMCMSTPVLEPTKVTFSVSPIEATEKCKKVEKGNRGLKNIPDSKEAPVNLCKPSLG
KSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSAS
SPSSVNSRQQTVLSRTPRSDLNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHR
VPRTTSAVKSNQEDVDKASSSNSACETGSVSALFQKIKGILPVKMESAECLEMTYVPNID
RISPEKKGEKENGTSMEKQELKQEIMNETFEYGSLFLGSASKTTTTSGRNISKPDSCGLR
QIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSGKPTSLKTAQSSWVNLPR
PLPKSKASLKSPALRRTGSTPSIASTHSELSTYSNNSGNAAVIKYEEKPPKPAFQNGSSG
SFYLKPLVSRAHVHLMKTPPKGPSRKNLFTALNAVEKSRQKNPRSLCIQPQTAPDALPPE
KTLELTQYKTKCENQSGFILQLKQLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQE
LVNLRGELVTASTTCEKLEKARNELQTVYEAFVQQHQAEKTERENRLKEFYTREYEKLRD
TYIEEAEKYKMQLQEQFDNLNAAHETSKLEIEASHSEKLELLKKAYEASLSEIKKGHEIE
KKSLEDLLSEKQESLEKQINDLKSENDALNEKLKSEEQKRRAREKANLKNPQIMYLEQEL
ESLKAVLEIKNEKLHQQDIKLMKMEKLVDNNTALVDKLKRFQQENEELKARMDKHMAISR
QLSTEQAVLQESLEKESKVNKRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSG
SFPSPSISPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5HZI1	0.161	0.168	0.000	1210	0.629	0.660	Q5HZI1.pdb.gz	MTUS1_MOUSE Microtubule-associated tumor suppressor 1 homolog OS=Mus musculus OX=10090 GN=Mtus1 PE=1 SV=2
2	AFDB:Q9ULD2	0.998	0.998	0.000	1270	1.000	1.000	Q9ULD2.pdb.gz	MTUS1_HUMAN Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2
3	AFDB:Q7SZL5	0.159	0.152	1.781E-45	1338	0.349	0.331	Q7SZL5.pdb.gz	MTUS1_XENLA Microtubule-associated tumor suppressor 1 homolog OS=Xenopus laevis OX=8355 GN=mtus1 PE=1 SV=1
4	AFDB:Q5JR59	0.168	0.158	4.325E-22	1369	0.231	0.215	Q5JR59.pdb.gz	MTUS2_HUMAN Microtubule-associated tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=MTUS2 PE=1 SV=3
5	AFDB:Q9VQM0	0.095	0.062	3.099E-7	2162	0.183	0.108	Q9VQM0.pdb.gz	Q9VQM0_DROME Toucan, isoform A OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=2
6	AFDB:Q8BI84	0.098	0.070	3.098E-4	1930	0.160	0.105	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
7	AFDB:D6RAA5	0.128	0.155	9.141E-4	1008	0.136	0.172	D6RAA5.pdb.gz	D6RAA5_HUMAN Transforming acidic coiled-coil containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
8	AFDB:Q9XZL7	0.088	0.092	3.185E-3	1190	0.121	0.129	Q9XZL7.pdb.gz	Q9XZL7_DROME Transforming acidic coiled-coil containing protein OS=Drosophila melanogaster OX=7227 GN=tacc PE=2 SV=1
9	AFDB:Q9Y6A5	0.113	0.160	6.199E-3	838	0.107	0.162	Q9Y6A5.pdb.gz	TACC3_HUMAN Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1
10	AFDB:Q0WR66	0.077	0.106	1.548E-2	793	0.102	0.163	Q0WR66.pdb.gz	ASY3_ARATH Meiosis-specific protein ASY3 OS=Arabidopsis thaliana OX=3702 GN=ASY3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5HZI1	0.0	1445	1210	0.623	0.654	MTUS1_MOUSE Microtubule-associated tumor suppressor 1 homolog OS=Mus musculus OX=10090 GN=Mtus1 PE=1 SV=2
2	Q6IMY1	0.0	671	440	0.283	0.816	MTUS1_RAT Microtubule-associated tumor suppressor 1 homolog OS=Rattus norvegicus OX=10116 GN=Mtus1 PE=1 SV=1
3	Q9ULD2	0.0	2628	1270	1.000	1.000	MTUS1_HUMAN Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2
4	Q7SZL5	1.22e-175	558	1338	0.309	0.294	MTUS1_XENLA Microtubule-associated tumor suppressor 1 homolog OS=Xenopus laevis OX=8355 GN=mtus1 PE=1 SV=1
5	Q5JR59	1.01e-53	208	1369	0.109	0.101	MTUS2_HUMAN Microtubule-associated tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=MTUS2 PE=1 SV=3
6	A6NI79	2.04e-17	86.7	296	0.050	0.216	CCD69_HUMAN Coiled-coil domain-containing protein 69 OS=Homo sapiens OX=9606 GN=CCDC69 PE=1 SV=1
7	Q99M73	0.006	43.5	603	0.036	0.076	KRT84_MOUSE Keratin, type II cuticular Hb4 OS=Mus musculus OX=10090 GN=Krt84 PE=2 SV=2
8	O14248	0.026	41.6	1125	0.041	0.046	TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tea3 PE=1 SV=1
9	Q0JJ05	0.035	40.8	987	0.044	0.057	NMCPB_ORYSJ Nuclear matrix constituent protein 1b OS=Oryza sativa subsp. japonica OX=39947 GN=NMCP1B PE=1 SV=1
10	Q9C0D2	0.10	39.7	2601	0.028	0.013	CE295_HUMAN Centrosomal protein of 295 kDa OS=Homo sapiens OX=9606 GN=CEP295 PE=1 SV=4
11	B0CN60	0.14	39.3	1569	0.055	0.045	B0CN60_NICBE Myosin XI-F OS=Nicotiana benthamiana OX=4100 PE=2 SV=1
12	Q0VF96	0.19	38.5	1302	0.065	0.063	CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens OX=9606 GN=CGNL1 PE=1 SV=2
13	A0A0G2JX94	0.21	38.5	1142	0.028	0.032	A0A0G2JX94_RAT Angiomotin OS=Rattus norvegicus OX=10116 GN=Amot PE=1 SV=2
14	P78559	0.22	38.5	2803	0.035	0.016	MAP1A_HUMAN Microtubule-associated protein 1A OS=Homo sapiens OX=9606 GN=MAP1A PE=1 SV=6
15	Q4VCS5	0.31	37.7	1084	0.029	0.034	AMOT_HUMAN Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1
16	O54874	0.32	37.7	1732	0.062	0.046	MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus OX=10116 GN=Cdc42bpa PE=1 SV=1
17	Q8VHG2	0.36	37.7	1126	0.028	0.032	AMOT_MOUSE Angiomotin OS=Mus musculus OX=10090 GN=Amot PE=1 SV=3
18	Q86YF9	0.37	37.7	867	0.034	0.050	DZIP1_HUMAN Cilium assembly protein DZIP1 OS=Homo sapiens OX=9606 GN=DZIP1 PE=1 SV=1
19	Q3UU96	0.41	37.7	1719	0.064	0.047	MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus OX=10090 GN=Cdc42bpa PE=1 SV=2
20	H5V864	0.45	37.4	2137	0.043	0.025	H5V864_DROME FI18374p1 OS=Drosophila melanogaster OX=7227 GN=Spn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01922 SRP19	8.9e+02	12.2	SRP19 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262102

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360973	0.906	Type-2 angiotensin II receptor
2	9606.ENSP00000404151	0.722	Centrosomal protein of 170 kDa protein B
3	9606.ENSP00000237353	0.682	Polyamine-modulated factor 1-binding protein 1
4	9606.ENSP00000382379	0.682	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A
5	9606.ENSP00000226432	0.678	PGAP2-interacting protein
6	9606.ENSP00000267116	0.676	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C
7	9606.ENSP00000478417	0.676	Serine/threonine-protein phosphatase 6 regulatory subunit 2
8	9606.ENSP00000474090	0.665	Uridine phosphorylase 2
9	9606.ENSP00000450482	0.640	B2 bradykinin receptor
10	9606.ENSP00000302297	0.637	Leucine-rich repeat LGI family member 3
11	9606.ENSP00000383392	0.619	Neural cell adhesion molecule 2
12	9606.ENSP00000378295	0.537	Inner centromere protein
13	9606.ENSP00000308583	0.536	Centromere protein S
14	9606.ENSP00000280191	0.534	Spermatogenesis-associated protein 4
15	9606.ENSP00000192788	0.517	UHRF1-binding protein 1
16	9606.ENSP00000381133	0.513	Fibrinogen-like protein 1
17	9606.ENSP00000359160	0.510	tRNA:m(4)X modification enzyme TRM13 homolog
18	9606.ENSP00000418721	0.508	Purine-rich element-binding protein gamma
19	9606.ENSP00000381298	0.506	LON peptidase N-terminal domain and ring finger 1
20	9606.ENSP00000419422	0.505	Type-1 angiotensin II receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.857	cellular process
GO:0048583	0.821	regulation of response to stimulus
GO:0030334	0.367	regulation of cell migration
GO:1905521	0.306	regulation of macrophage migration
GO:0032101	0.300	regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005737	0.988	cytoplasm
GO:0005576	0.949	extracellular region
GO:0005615	0.870	extracellular space
GO:0015630	0.866	microtubule cytoskeleton
GO:0005730	0.775	nucleolus
GO:0005654	0.550	nucleoplasm
GO:0005829	0.449	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]