StarFunc result for job id Q9ULD4

User Input

>input (1205 residues)
MRKPRRKSRQNAEGRRSPSPYSLKCSPTRETLTYAQAQRIVEVDIDGRLHRISIYDPLKI
ITEDELTAQDITECNSNKENSEQPQFPGKSKKPSSKGKKKESCSKHASGTSFHLPQPSFR
MVDSGIQPEAPPLPAAYYRYIEKPPEDLDAEVEYDMDEEDLAWLDMVNEKRRVDGHSLVS
ADTFELLVDRLEKESYLESRSSGAQQSLIDEDAFCCVCLDDECHNSNVILFCDICNLAVH
QECYGVPYIPEGQWLCRCCLQSPSRPVDCILCPNKGGAFKQTSDGHWAHVVCAIWIPEVC
FANTVFLEPIEGIDNIPPARWKLTCYICKQKGLGAAIQCHKVNCYTAFHVTCAQRAGLFM
KIEPMRETSLNGTIFTVRKTAYCEAHSPPGAATARRKGDSPRSISETGDEEGLKEGDGEE
EEEEEVEEEEQEAQGGVSGSLKGVPKKSKMSLKQKIKKEPEEAGQDTPSTLPMLAVPQIP
SYRLNKICSGLSFQRKNQFMQRLHNYWLLKRQARNGVPLIRRLHSHLQSQRNAEQREQDE
KTSAVKEELKYWQKLRHDLERARLLIELIRKREKLKREQVKVQQAAMELELMPFNVLLRT
TLDLLQEKDPAHIFAEPVNLSEVPDYLEFISKPMDFSTMRRKLESHLYRTLEEFEEDFNL
IVTNCMKYNAKDTIFHRAAVRLRDLGGAILRHARRQAENIGYDPERGTHLPESPKLEDFY
RFSWEDVDNILIPENRAHLSPEVQLKELLEKLDLVSAMRSSGARTRRVRLLRREINALRQ
KLAQPPPPQPPSLNKTVSNGELPAGPQGDAAVLEQALQEEPEDDGDRDDSKLPPPPTLEP
TGPAPSLSEQESPPEPPTLKPINDSKPPSRFLKPRKVEEDELLEKSPLQLGNEPLQRLLS
DNGINRLSLMAPDTPAGTPLSGVGRRTSVLFKKAKNGVKLQRSPDRVLENGEDHGVAGSP
ASPASIEEERHSRKRPRSRSCSESEGERSPQQEEETGMTNGFGKHTESGSDSECSLGLSG
GLAFEACSGLTPPKRSRGKPALSRVPFLEGVNGDSDYNGSGRSLLLPFEDRGDLEPLELV
WAKCRGYPSYPALIIDPKMPREGLLHNGVPIPVPPLDVLKLGEQKQAEAGEKLFLVLFFD
NKRTWQWLPRDKVLPLGVEDTVDKLKMLEGRKTSIRKSVQVAYDRAMIHLSRVRGPHSFV
TSSYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R4V5	0.383	0.386	0.000	1189	0.530	0.537	A0A024R4V5.pdb.gz
2	AFDB:Q9ULD4	1.000	1.000	0.000	1205	1.000	1.000	Q9ULD4.pdb.gz	BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens OX=9606 GN=BRPF3 PE=1 SV=2
3	AFDB:A0A5F9ZH11	0.246	0.238	1.117E-98	1253	0.505	0.485	A0A5F9ZH11.pdb.gz	A0A5F9ZH11_HUMAN Bromodomain and PHD finger containing 1 OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
4	AFDB:P55201	0.240	0.238	5.006E-98	1214	0.499	0.495	P55201.pdb.gz	BRPF1_HUMAN Peregrin OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
5	AFDB:B2YCZ4	0.226	0.217	6.150E-96	1258	0.478	0.458	B2YCZ4.pdb.gz
6	AFDB:Q7JVP4	0.225	0.194	4.451E-74	1430	0.373	0.315	Q7JVP4.pdb.gz	BRDH_DROME Bromodomain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Br140 PE=1 SV=1
7	AFDB:H9GXF8	0.229	0.222	1.100E-72	1248	0.424	0.409	H9GXF8.pdb.gz
8	AFDB:A0A0B4KGP1	0.142	0.102	3.146E-12	1717	0.122	0.086	A0A0B4KGP1.pdb.gz	A0A0B4KGP1_DROME Alhambra, isoform P OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
9	AFDB:E9Q2Z1	0.083	0.069	1.730E-7	1453	0.105	0.087	E9Q2Z1.pdb.gz	CECR2_MOUSE Chromatin remodeling regulator CECR2 OS=Mus musculus OX=10090 GN=Cecr2 PE=1 SV=1
10	AFDB:Q9BXF3	0.085	0.070	1.443E-6	1484	0.120	0.097	Q9BXF3.pdb.gz	CECR2_HUMAN Chromatin remodeling regulator CECR2 OS=Homo sapiens OX=9606 GN=CECR2 PE=1 SV=2
11	PDB:5datl6	0.044	0.242	2.236E-1	157	0.020	0.153	5datl6.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
12	PDB:7pzyn	0.047	0.281	2.750E-1	155	0.016	0.123	7pzyn.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
13	PDB:4v8mBa	0.049	0.337	5.116E-1	132	0.014	0.129	4v8mBa.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
14	PDB:3pjaL	0.056	0.209	5.388E-1	223	0.022	0.117	3pjaL.pdb.gz
15	PDB:6s01K	0.057	0.614	5.674E-1	86	0.017	0.233	6s01K.pdb.gz	Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.
16	PDB:7f61A	0.047	0.133	7.348E-1	301	0.031	0.123	7f61A.pdb.gz	Structural basis for recognition of antihistamine drug by human histamine receptor.
17	PDB:4v8mBv	0.048	0.287	8.582E-1	157	0.008	0.064	4v8mBv.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
18	PDB:3wxxG	0.056	0.337	9.038E-1	151	0.017	0.139	3wxxG.pdb.gz	Structure of AcrH-AopB Chaperone-Translocator Complex Reveals a Role for Membrane Hairpins in Type III Secretion System Translocon Assembly
19	PDB:4pz6A	0.048	0.119	9.038E-1	373	0.012	0.040	4pz6A.pdb.gz	How an mRNA capping enzyme reads distinct RNA polymerase II and Spt5 CTD phosphorylation codes.
20	PDB:8dvsA	0.058	0.091	9.517E-1	682	0.017	0.031	8dvsA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A5F9ZH11	0.0	897	1253	0.383	0.369	A0A5F9ZH11_HUMAN Bromodomain and PHD finger containing 1 OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
2	B2RRD7	0.0	907	1212	0.384	0.382	BRPF1_MOUSE Peregrin OS=Mus musculus OX=10090 GN=Brpf1 PE=1 SV=1
3	D3ZUW8	0.0	1170	1189	0.542	0.549	D3ZUW8_RAT Bromodomain containing 1 OS=Rattus norvegicus OX=10116 GN=Brd1 PE=4 SV=3
4	G5E8P1	0.0	945	1058	0.390	0.444	BRD1_MOUSE Bromodomain-containing protein 1 OS=Mus musculus OX=10090 GN=Brd1 PE=1 SV=1
5	O95696	0.0	910	1058	0.396	0.451	BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens OX=9606 GN=BRD1 PE=1 SV=1
6	P55201	0.0	904	1214	0.383	0.381	BRPF1_HUMAN Peregrin OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
7	Q7JVP4	0.0	605	1430	0.269	0.227	BRDH_DROME Bromodomain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Br140 PE=1 SV=1
8	Q803M2	0.0	828	899	0.363	0.487	Q803M2_DANRE Bromodomain and PHD finger containing, 1 OS=Danio rerio OX=7955 GN=zgc:55530 PE=2 SV=1
9	Q9ULD4	0.0	2476	1205	1.000	1.000	BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens OX=9606 GN=BRPF3 PE=1 SV=2
10	Q12311	1.09e-63	234	748	0.130	0.210	NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTO1 PE=1 SV=1
11	O74759	6.97e-60	223	767	0.123	0.193	NTO1_SCHPO Mst2 complex subunit nto1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nto1 PE=1 SV=1
12	Q7YZH1	3.68e-57	220	3241	0.120	0.044	RNO_DROME PHD finger protein rhinoceros OS=Drosophila melanogaster OX=7227 GN=rno PE=1 SV=1
13	Q6IE81	2.83e-55	210	842	0.127	0.182	JADE1_HUMAN Protein Jade-1 OS=Homo sapiens OX=9606 GN=JADE1 PE=1 SV=1
14	Q92613	6.21e-54	206	823	0.131	0.192	JADE3_HUMAN Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1
15	Q803A0	1.20e-52	202	829	0.115	0.168	JADE1_DANRE Protein Jade-1 OS=Danio rerio OX=7955 GN=jade1 PE=2 SV=1
16	Q6ZQF7	7.28e-50	193	829	0.117	0.170	JADE2_MOUSE E3 ubiquitin-protein ligase Jade-2 OS=Mus musculus OX=10090 GN=Jade2 PE=1 SV=2
17	A0A087X085	8.45e-45	177	833	0.085	0.122	A0A087X085_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=2
18	G3XAA4	8.59e-45	177	834	0.085	0.122	G3XAA4_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
19	Q9NQC1	1.12e-44	177	790	0.085	0.129	JADE2_HUMAN E3 ubiquitin-protein ligase Jade-2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=2
20	A0A0C4DFT8	1.19e-44	176	791	0.085	0.129	A0A0C4DFT8_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	1.1e-20	84.8	Bromodomain
2	PF12310 Elf-1_N	4.5e+02	12.9	Transcription factor protein N terminal
3	PF10513 EPL1	2e-29	114.8	Enhancer of polycomb-like
4	PF02318 FYVE_2	34	16.0	FYVE-type zinc finger
5	PF00628 PHD	0.0046	28.1	PHD-finger
6	PF13831 PHD_2	7.1e-09	46.3	PHD-finger
7	PF00855 PWWP	2.3e-10	52.1	PWWP domain
8	PF13771 zf-HC5HC2H	8.1e-22	88.6	PHD-like zinc-binding domain
9	PF13832 zf-HC5HC2H_2	2.6e-32	122.6	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350267

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259021	0.998	Histone acetyltransferase KAT7
2	9606.ENSP00000362166	0.995	Chromatin modification-related protein MEAF6
3	9606.ENSP00000322142	0.988	Inhibitor of growth protein 5
4	9606.ENSP00000287239	0.977	Histone acetyltransferase KAT6B
5	9606.ENSP00000380136	0.977	Histone acetyltransferase KAT6A
6	9606.ENSP00000362649	0.923	Histone deacetylase 1
7	9606.ENSP00000369716	0.921	Chromodomain-helicase-DNA-binding protein 3
8	9606.ENSP00000430432	0.920	Histone deacetylase 2
9	9606.ENSP00000216267	0.919	Bromodomain-containing protein 1
10	9606.ENSP00000373340	0.917	Peregrin
11	9606.ENSP00000349508	0.915	Chromodomain-helicase-DNA-binding protein 4
12	9606.ENSP00000467141	0.910	Titin
13	9606.ENSP00000270142	0.905	Superoxide dismutase [Cu-Zn]
14	9606.ENSP00000358866	0.904	Filamin-A
15	9606.ENSP00000248437	0.903	Tubulin alpha-4A chain
16	9606.ENSP00000278823	0.903	Metastasis-associated protein MTA2
17	9606.ENSP00000211998	0.902	Vinculin
18	9606.ENSP00000263826	0.902	RAC-gamma serine/threonine-protein kinase
19	9606.ENSP00000362592	0.902	Histone-binding protein RBBP4
20	9606.ENSP00000369424	0.902	Histone-binding protein RBBP7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0010485	1.000	histone H4 acetyltransferase activity
GO:0010484	0.999	histone H3 acetyltransferase activity
GO:0043996	0.879	histone H4K8 acetyltransferase activity
GO:0043995	0.879	histone H4K5 acetyltransferase activity
GO:0043997	0.873	histone H4K12 acetyltransferase activity
GO:0036408	0.837	histone H3K14 acetyltransferase activity
GO:0042393	0.733	histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0080090	0.968	regulation of primary metabolic process
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0031323	0.968	regulation of cellular metabolic process
GO:0019219	0.962	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.945	positive regulation of cellular process
GO:0060255	0.909	regulation of macromolecule metabolic process
GO:0031325	0.891	positive regulation of cellular metabolic process
GO:0051173	0.890	positive regulation of nitrogen compound metabolic process
GO:0051052	0.878	regulation of DNA metabolic process
GO:0045935	0.874	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.865	positive regulation of macromolecule metabolic process
GO:0006275	0.843	regulation of DNA replication
GO:0071704	0.738	organic substance metabolic process
GO:0051054	0.647	positive regulation of DNA metabolic process
GO:0044238	0.632	primary metabolic process
GO:0009987	0.605	cellular process
GO:0006807	0.597	nitrogen compound metabolic process
GO:0010468	0.566	regulation of gene expression
GO:0009889	0.547	regulation of biosynthetic process
GO:0043170	0.539	macromolecule metabolic process
GO:0031326	0.518	regulation of cellular biosynthetic process
GO:0036211	0.490	protein modification process
GO:0016570	0.470	histone modification
GO:0010556	0.469	regulation of macromolecule biosynthetic process
GO:0051252	0.449	regulation of RNA metabolic process
GO:0045740	0.438	positive regulation of DNA replication
GO:0006355	0.435	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0000785	0.999	chromatin
GO:1990234	0.997	transferase complex
GO:0005829	0.997	cytosol
GO:0140535	0.994	intracellular protein-containing complex
GO:0005654	0.986	nucleoplasm
GO:0000123	0.979	histone acetyltransferase complex
GO:0005576	0.969	extracellular region
GO:0070775	0.953	H3 histone acetyltransferase complex
GO:0016020	0.578	membrane
GO:0070776	0.499	MOZ/MORF histone acetyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	1.000	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	1.000	histone acetyltransferase.

[back to server]