StarFunc result for job id Q9ULD8

User Input

>input (1083 residues)
MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEV
MQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEK
GEVALFLVSHKDISETKNRGGPDRWKETGGGRRRYGRARSKGFNANRRRSRAVLYHLSGH
LQKQPKGKHKLNKGVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAV
TVPYSVCVSTAREPSAARGPPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICL
HYVTTWFLLDVIAALPFDLLHAFKVNVYFGAHLLKTVRLLRLLRLLPRLDRYSQYSAVVL
TLLMAVFALLAHWVACVWFYIGQREIESSESELPEIGWLQELARRLETPYYLVGRRPAGG
NSSGQSDNCSSSSEANGTGLELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDTEKI
FSICTMLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHRIPKPLKQRMLE
YFQATWAVNNGIDTTELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLALRP
AFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELPRREQVVKANA
DVKGLTYCVLQCLQLAGLHDSLALYPEFAPRFSRGLRGELSYNLGAGGGSAEVDTSSLSG
DNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLG
GRGRPGRAGALKAEAGPSAPPRALEGLRLPPMPWNVPPDLSPRVVDGIEDGCGSDQPKFS
FRVGQSGPECSSSPSPGPESGLLTVPHGPSEARNTDTLDKLRQAVTELSEQVLQMREGLQ
SLRQAVQLVLAPHREGPCPRASGEGPCPASTSGLLQPLCVDTGASSYCLQPPAGSVLSGT
WPHPRPGPPPLMAPWPWGPPASQSSPWPRATAFWTSTSDSEPPASGDLCSEPSTPASPPP
SEEGARTGPAEPVSQAEATSTGEPPPGSGGLALPWDPHSLEMVLIGCHGSGTVQWTQEEG
TGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULD8	1.000	1.000	0.000	1083	1.000	1.000	Q9ULD8.pdb.gz	KCNH3_HUMAN Potassium voltage-gated channel subfamily H member 3 OS=Homo sapiens OX=9606 GN=KCNH3 PE=1 SV=2
2	AFDB:A8WHX9	0.634	0.739	2.815E-95	914	0.511	0.605	A8WHX9.pdb.gz	A8WHX9_DANRE Potassium voltage-gated channel, subfamily H (eag-related), member 3 (Fragment) OS=Danio rerio OX=7955 GN=kcnh3 PE=1 SV=1
3	AFDB:Q96L42	0.611	0.598	3.095E-90	1107	0.496	0.485	Q96L42.pdb.gz	KCNH8_HUMAN Potassium voltage-gated channel subfamily H member 8 OS=Homo sapiens OX=9606 GN=KCNH8 PE=2 SV=2
4	AFDB:Q9UQ05	0.640	0.680	2.173E-87	1017	0.477	0.508	Q9UQ05.pdb.gz	KCNH4_HUMAN Potassium voltage-gated channel subfamily H member 4 OS=Homo sapiens OX=9606 GN=KCNH4 PE=2 SV=1
5	AFDB:Q38849	0.362	0.542	1.013E-28	697	0.118	0.184	Q38849.pdb.gz	KAT2_ARATH Potassium channel KAT2 OS=Arabidopsis thaliana OX=3702 GN=KAT2 PE=1 SV=3
6	PDB:7rhsA	0.361	0.806	1.715E-26	456	0.111	0.263	7rhsA.pdb.gz
7	PDB:7n15A	0.342	0.665	6.277E-23	520	0.098	0.204	7n15A.pdb.gz	Structural and functional characterization of an achromatopsia-associated mutation in a phototransduction channel.
8	PDB:7rhsD	0.339	0.768	3.272E-22	441	0.082	0.202	7rhsD.pdb.gz
9	PDB:7wswA	0.327	0.693	6.930E-22	472	0.089	0.203	7wswA.pdb.gz
10	PDB:7calA	0.349	0.807	3.798E-21	444	0.093	0.227	7calA.pdb.gz
11	PDB:7o4hB	0.346	0.741	5.128E-21	468	0.106	0.246	7o4hB.pdb.gz
12	PDB:7xufA	0.329	0.683	2.810E-20	476	0.095	0.216	7xufA.pdb.gz
13	PDB:7o4hD	0.252	0.646	2.521E-12	383	0.072	0.204	7o4hD.pdb.gz
14	PDB:2wkpA	0.096	0.317	4.353E-8	320	0.037	0.125	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
15	PDB:6eo1A	0.113	0.252	6.488E-7	355	0.076	0.231	6eo1A.pdb.gz
16	AFDB:P97445	0.094	0.057	1.891E-3	2368	0.117	0.054	P97445.pdb.gz	CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus OX=10090 GN=Cacna1a PE=1 SV=2
17	AFDB:Q9BX84	0.107	0.070	2.198E-3	2022	0.108	0.058	Q9BX84.pdb.gz	TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2
18	AFDB:Q9HCF6	0.107	0.079	4.655E-3	1732	0.121	0.076	Q9HCF6.pdb.gz	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
19	AFDB:P15381	0.104	0.064	8.477E-2	2171	0.109	0.054	P15381.pdb.gz	CAC1C_RABIT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Oryctolagus cuniculus OX=9986 GN=CACNA1C PE=1 SV=1
20	AFDB:Q57VV6	0.053	0.034	1.203E-1	2127	0.134	0.068	Q57VV6.pdb.gz	Q57VV6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.29K2.790 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8WHX9	0.0	988	914	0.503	0.596	A8WHX9_DANRE Potassium voltage-gated channel, subfamily H (eag-related), member 3 (Fragment) OS=Danio rerio OX=7955 GN=kcnh3 PE=1 SV=1
2	O54853	0.0	555	950	0.287	0.327	KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus OX=10116 GN=Kcnh6 PE=1 SV=1
3	Q96L42	0.0	955	1107	0.486	0.475	KCNH8_HUMAN Potassium voltage-gated channel subfamily H member 8 OS=Homo sapiens OX=9606 GN=KCNH8 PE=2 SV=2
4	Q9QWS8	0.0	951	1102	0.496	0.487	KCNH8_RAT Potassium voltage-gated channel subfamily H member 8 OS=Rattus norvegicus OX=10116 GN=Kcnh8 PE=2 SV=2
5	Q9ULD8	0.0	2203	1083	1.000	1.000	KCNH3_HUMAN Potassium voltage-gated channel subfamily H member 3 OS=Homo sapiens OX=9606 GN=KCNH3 PE=1 SV=2
6	Q9UQ05	0.0	869	1017	0.486	0.517	KCNH4_HUMAN Potassium voltage-gated channel subfamily H member 4 OS=Homo sapiens OX=9606 GN=KCNH4 PE=2 SV=1
7	Q9H252	1.46e-178	550	994	0.279	0.304	KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1
8	Q63472	1.11e-173	536	962	0.267	0.300	KCNH1_RAT Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus OX=10116 GN=Kcnh1 PE=1 SV=1
9	K4EHU2	1.91e-170	528	956	0.262	0.297	K4EHU2_DANRE Potassium voltage-gated channel subfamily H member 1b OS=Danio rerio OX=7955 GN=Eag1 PE=2 SV=1
10	Q60603	2.69e-170	528	989	0.268	0.293	KCNH1_MOUSE Potassium voltage-gated channel subfamily H member 1 OS=Mus musculus OX=10090 GN=Kcnh1 PE=1 SV=2
11	Q108P3	3.52e-170	527	959	0.266	0.300	Q108P3_DANRE Potassium voltage-gated channel subfamily H member 1 OS=Danio rerio OX=7955 GN=Eag1 PE=2 SV=1
12	O95259	8.43e-170	527	989	0.267	0.292	KCNH1_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
13	Q9EPI9	5.64e-169	525	988	0.258	0.282	KCNH5_RAT Potassium voltage-gated channel subfamily H member 5 OS=Rattus norvegicus OX=10116 GN=Kcnh5 PE=2 SV=1
14	O18965	7.70e-169	525	987	0.266	0.292	KCNH1_BOVIN Potassium voltage-gated channel subfamily H member 1 OS=Bos taurus OX=9913 GN=KCNH1 PE=2 SV=2
15	Q8NCM2	9.68e-169	524	988	0.258	0.282	KCNH5_HUMAN Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens OX=9606 GN=KCNH5 PE=1 SV=3
16	Q02280	3.66e-162	512	1174	0.255	0.235	KCNAE_DROME Potassium voltage-gated channel protein eag OS=Drosophila melanogaster OX=7227 GN=eag PE=1 SV=2
17	O44164	2.14e-151	478	956	0.254	0.288	O44164_CAEEL Potassium voltage-gated channel protein eag OS=Caenorhabditis elegans OX=6239 GN=egl-2 PE=4 SV=2
18	O08962	1.20e-139	452	1163	0.278	0.259	KCNH2_RAT Potassium voltage-gated channel subfamily H member 2 OS=Rattus norvegicus OX=10116 GN=Kcnh2 PE=1 SV=1
19	O35219	1.75e-138	449	1162	0.278	0.259	KCNH2_MOUSE Potassium voltage-gated channel subfamily H member 2 OS=Mus musculus OX=10090 GN=Kcnh2 PE=1 SV=2
20	Q9NS40	7.00e-137	446	1196	0.216	0.196	KCNH7_HUMAN Potassium voltage-gated channel subfamily H member 7 OS=Homo sapiens OX=9606 GN=KCNH7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	0.0013	30.1	Cyclic nucleotide-binding domain
2	PF20072 DUF6468	6.7e+02	11.8	Domain of unknown function (DUF6468)
3	PF00520 Ion_trans	3.3e-28	110.1	Ion transport protein
4	PF07885 Ion_trans_2	2e-08	45.4	Ion channel
5	PF00989 PAS	0.028	25.8	PAS fold
6	PF08447 PAS_3	0.008	27.8	PAS fold
7	PF08448 PAS_4	0.0043	28.7	PAS fold
8	PF13426 PAS_9	4.5e-14	64.0	PAS domain
9	PF05116 S6PP	2.2e+02	12.8	Sucrose-6F-phosphate phosphohydrolase
10	PF14377 UBM	3.7	18.3	Ubiquitin binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257981

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302719	0.872	Voltage-gated potassium channel subunit beta-3
2	9606.ENSP00000295082	0.855	Potassium voltage-gated channel subfamily F member 1
3	9606.ENSP00000483056	0.818	ETS domain-containing protein Elk-1
4	9606.ENSP00000265969	0.813	Potassium voltage-gated channel subfamily C member 1
5	9606.ENSP00000373648	0.811	Potassium voltage-gated channel subfamily KQT member 3
6	9606.ENSP00000444948	0.805	Potassium channel subfamily K member 4
7	9606.ENSP00000262916	0.780	Potassium voltage-gated channel subfamily KQT member 4
8	9606.ENSP00000367323	0.775	Voltage-gated potassium channel subunit beta-2
9	9606.ENSP00000434241	0.769	Potassium voltage-gated channel subfamily C member 3
10	9606.ENSP00000419952	0.761	Voltage-gated potassium channel subunit beta-1
11	9606.ENSP00000287042	0.757	Potassium voltage-gated channel subfamily S member 2
12	9606.ENSP00000352035	0.752	Potassium voltage-gated channel subfamily KQT member 2
13	9606.ENSP00000371985	0.745	Potassium voltage-gated channel subfamily A member 1
14	9606.ENSP00000449253	0.742	Potassium voltage-gated channel subfamily C member 2
15	9606.ENSP00000358802	0.741	Potassium voltage-gated channel subfamily C member 4
16	9606.ENSP00000433109	0.738	Potassium voltage-gated channel subfamily A member 2
17	9606.ENSP00000221444	0.728	Potassium voltage-gated channel subfamily A member 7
18	9606.ENSP00000365962	0.728	TBC1 domain family member 25
19	9606.ENSP00000360806	0.720	Potassium voltage-gated channel subfamily B member 1
20	9606.ENSP00000345055	0.716	Potassium voltage-gated channel subfamily KQT member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005249	1.000	voltage-gated potassium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006811	0.996	monoatomic ion transport
GO:0030001	0.991	metal ion transport
GO:0006813	0.983	potassium ion transport
GO:0065007	0.604	biological regulation
GO:0050789	0.533	regulation of biological process
GO:0009987	0.492	cellular process
GO:0050794	0.414	regulation of cellular process
GO:0055085	0.320	transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.940	protein-containing complex
GO:1902495	0.354	transmembrane transporter complex
GO:0005622	0.307	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]