StarFunc result for job id Q9ULD9

User Input

>input (1512 residues)
MSVNISTAGKGVDPNTVDTYDSGDDWEIGVGNLIIDLDADLEKDRQKFEMNNSTTTTSSS
NSKDCGGPASSGAGATAALADGLKFASVQASAPQGNSHKETSKSKVKRSKTSKDANKSLP
SAALYGIPEISSTGKRQEVQGRPGEATGMNSALGQSVSSGGSGNPNSNSTSTSTSAATAG
AGSCGKSKEEKPGKSQSSRGAKRDKDAGKSRKDKHDLLQGHQNGSGSQAPSGGHLYGFGA
KSNGGGASPFHCGGTGSGSVAAAGEVSKSAPDSGLMGNSMLVKKEEEEEESHRRIKKLKT
EKVDPLFTVPAPPPPISSSLTPQILPSYFSPSSSNIAAPVEQLLVRTRSVGVNTCEVGVV
TEPECLGPCEPGTSVNLEGIVWHETEEGVLVVNVTWRNKTYVGTLLDCTKHDWAPPRFCE
SPTSDLEMRGGRGRGKRARSAAAAPGSEASFTESRGLQNKNRGGANGKGRRGSLNASGRR
TPPNCAAEDIKASPSSTNKRKNKPPMELDLNSSSEDNKPGKRVRTNSRSTPTTPQGKPET
TFLDQGCSSPVLIDCPHPNCNKKYKHINGLRYHQAHAHLDPENKLEFEPDSEDKISDCEE
GLSNVALECSEPSTSVSAYDQLKAPASPGAGNPPGTPKGKRELMSNGPGSIIGAKAGKNS
GKKKGLNNELNNLPVISNMTAALDSCSAADGSLAAEMPKLEAEGLIDKKNLGDKEKGKKA
TNCKTDKNLSKLKSARPIAPAPAPTPPQLIAIPTATFTTTTTGTIPGLPSLTTTVVQATP
KSPPLKPIQPKPTIMGEPITVNPALVSLKDKKKKEKRKLKDKEGKETGSPKMDAKLGKLE
DSKGASKDLPGHFLKDHLNKNEGLANGLSESQESRMASIKAEADKVYTFTDNAPSPSIGS
ASRLECSTLVNGQAPMAPLHVLTQNGAESSAAKTSSPAYSDISDAADDGGSDSRSEGMRS
KASSPSDIISSKDSVVKGHSSTTAQSSQLKESHSPYYHSYDPYYSPSYMHPGQVGAPAAG
NSGSTQGMKIKKESEEDAEKKDKAEQLDSKKVDHNSASLQPQHQSVITQRHPALAQSLYY
GQYAYGLYMDQKSLMATSPAYRQQYEKYYEDQRLAEQKMAQTGRGDCERKSELPLKELGK
EETKQKNMPSATISKAPSTPEPNKNHSKLGPSVPNKTEETGKSQLLSNHQQQLQADSFKA
KQMENHQLIKEAVEMKSVMDSMKQTGVDPTSRFKQDPDSRTWHHYVYQPKYLDQQKSEEL
DREKKLKEDSPRKTPNKESGVPSLPVSLTSIKEEPKEAKHPDSQSMEESKLKNDDRKTPV
NWKDSRGTRVAVSSPMSQHQSYIQYLHAYPYPQMYDPSHPAYRAVSPVLMHSYPGAYLSP
GFHYPVYGKMSGREETEKVNTSPSVNTKTTTESKALDLLQQHANQYRSKSPAPVEKATAE
REREAERERDRHSPFGQRHLHTHHHTHVGMGYPLIPGQYDPFQGLTSAALVASQQVAAQA
SASGMFPGQRRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q56A10	0.314	0.314	0.000	1511	0.929	0.930	Q56A10.pdb.gz	ZN608_MOUSE Zinc finger protein 608 OS=Mus musculus OX=10090 GN=Znf608 PE=1 SV=1
2	AFDB:Q8BZ47	0.094	0.099	1.255E-69	1413	0.426	0.456	Q8BZ47.pdb.gz	ZN609_MOUSE Zinc finger protein 609 OS=Mus musculus OX=10090 GN=Znf609 PE=1 SV=2
3	AFDB:E7F226	0.031	0.031	9.474E-6	1531	0.124	0.123	E7F226.pdb.gz
4	AFDB:Q9P2R6	0.038	0.037	4.254E-4	1566	0.111	0.107	Q9P2R6.pdb.gz	RERE_HUMAN Arginine-glutamic acid dipeptide repeats protein OS=Homo sapiens OX=9606 GN=RERE PE=1 SV=2
5	AFDB:A0A0R4IJ26	0.042	0.037	6.264E-4	1760	0.155	0.134	A0A0R4IJ26.pdb.gz
6	AFDB:F1R3C6	0.031	0.028	7.601E-4	1855	0.105	0.086	F1R3C6.pdb.gz	F1R3C6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet1 PE=2 SV=1
7	AFDB:Q9BYP7	0.037	0.033	1.448E-3	1800	0.118	0.099	Q9BYP7.pdb.gz	WNK3_HUMAN Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3 PE=1 SV=3
8	AFDB:Q7KMH9	0.041	0.043	1.648E-3	1420	0.120	0.128	Q7KMH9.pdb.gz	Q7KMH9_DROME BcDNA.LD26050 OS=Drosophila melanogaster OX=7227 GN=wde PE=1 SV=1
9	AFDB:Q9NZM4	0.038	0.038	1.648E-3	1560	0.157	0.152	Q9NZM4.pdb.gz	BICRA_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein OS=Homo sapiens OX=9606 GN=BICRA PE=1 SV=2
10	AFDB:Q03661	0.033	0.034	1.758E-3	1658	0.156	0.142	Q03661.pdb.gz	ESC1_YEAST Silent chromatin protein ESC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ESC1 PE=1 SV=1
11	PDB:6c6sD	0.022	0.193	1.512	161	0.003	0.025	6c6sD.pdb.gz	Structural Basis for Transcript Elongation Control by NusG Family Universal Regulators.
12	PDB:4wspA	0.018	0.237	1.834	79	0.005	0.089	4wspA.pdb.gz
13	PDB:3tygL	0.014	0.083	2.087	207	0.003	0.024	3tygL.pdb.gz	A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.
14	PDB:1yykA	0.021	0.120	2.226	221	0.003	0.018	1yykA.pdb.gz	Intermediate states of ribonuclease III in complex with double-stranded RNA
15	PDB:7zpkC	0.021	0.119	2.374	233	0.002	0.013	7zpkC.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
16	PDB:6b2eB	0.017	0.094	2.532	193	0.010	0.078	6b2eB.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
17	PDB:1lfoA	0.017	0.175	2.701	128	0.003	0.031	1lfoA.pdb.gz	The crystal structure of the liver fatty acid-binding protein. A complex with two bound oleates.
18	PDB:7pmyA	0.012	0.027	2.701	657	0.001	0.002	7pmyA.pdb.gz	Structural snapshots of human PepT1 and PepT2 reveal mechanistic insights into substrate and drug transport across epithelial membranes.
19	PDB:7r97A	0.021	0.124	2.701	226	0.004	0.027	7r97A.pdb.gz	Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
20	PDB:6drtA	0.019	0.099	2.881	230	0.003	0.022	6drtA.pdb.gz	T4 DNA ligase structure reveals a prototypical ATP-dependent ligase with a unique mode of sliding clamp interaction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15014	0.0	889	1411	0.446	0.478	ZN609_HUMAN Zinc finger protein 609 OS=Homo sapiens OX=9606 GN=ZNF609 PE=1 SV=2
2	Q56A10	0.0	2620	1511	0.931	0.931	ZN608_MOUSE Zinc finger protein 608 OS=Mus musculus OX=10090 GN=Znf608 PE=1 SV=1
3	Q8BZ47	0.0	888	1413	0.453	0.485	ZN609_MOUSE Zinc finger protein 609 OS=Mus musculus OX=10090 GN=Znf609 PE=1 SV=2
4	Q9N693	1.92e-52	206	2302	0.083	0.054	Q9N693_DROME Brakeless-B OS=Drosophila melanogaster OX=7227 GN=sbb PE=1 SV=1
5	Q8T9H1	2.00e-52	206	1928	0.083	0.065	Q8T9H1_DROME SD01229p OS=Drosophila melanogaster OX=7227 GN=sbb PE=2 SV=1
6	Q9GRA9	2.14e-52	206	2310	0.083	0.054	Q9GRA9_DROME Master of thick veins OS=Drosophila melanogaster OX=7227 GN=sbb PE=1 SV=1
7	E1JGL0	2.15e-52	206	2312	0.083	0.054	E1JGL0_DROME Scribbler, isoform G OS=Drosophila melanogaster OX=7227 GN=sbb PE=1 SV=1
8	A0A0B4KEU2	2.34e-52	206	2330	0.083	0.054	A0A0B4KEU2_DROME Scribbler, isoform J OS=Drosophila melanogaster OX=7227 GN=sbb PE=1 SV=1
9	Q8SX80	7.90e-32	134	555	0.037	0.101	Q8SX80_DROME LD21711p OS=Drosophila melanogaster OX=7227 GN=sbb PE=2 SV=1
10	Q9NGW5	2.03e-31	136	929	0.037	0.060	Q9NGW5_DROME Brakeless protein OS=Drosophila melanogaster OX=7227 GN=sbb PE=2 SV=1
11	A1ZB51	2.45e-31	136	939	0.037	0.060	A1ZB51_DROME Scribbler, isoform F OS=Drosophila melanogaster OX=7227 GN=sbb PE=4 SV=1
12	Q9NBL3	2.53e-31	135	929	0.037	0.060	Q9NBL3_DROME Scribbler short isoform OS=Drosophila melanogaster OX=7227 GN=sbb PE=2 SV=1
13	Q9NHQ0	2.54e-31	136	939	0.037	0.060	Q9NHQ0_DROME Scribbler OS=Drosophila melanogaster OX=7227 GN=sbb PE=2 SV=1
14	Q9NBW0	2.55e-31	135	929	0.037	0.060	Q9NBW0_DROME Brakeless-A OS=Drosophila melanogaster OX=7227 GN=sbb PE=2 SV=1
15	Q9UTH8	4.25e-06	53.5	442	0.024	0.081	SFP1_SCHPO Zinc finger protein sfp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sfp1 PE=4 SV=1
16	C9JWY1	0.033	39.3	173	0.008	0.069	C9JWY1_HUMAN JAZF zinc finger 1 (Fragment) OS=Homo sapiens OX=9606 GN=JAZF1 PE=1 SV=1
17	C9JGY8	0.034	39.7	181	0.008	0.066	C9JGY8_HUMAN JAZF zinc finger 1 (Fragment) OS=Homo sapiens OX=9606 GN=JAZF1 PE=1 SV=1
18	H0Y403	0.16	38.1	230	0.008	0.052	H0Y403_HUMAN JAZF zinc finger 1 (Fragment) OS=Homo sapiens OX=9606 GN=JAZF1 PE=1 SV=1
19	Q86VZ6	0.24	37.7	243	0.008	0.049	JAZF1_HUMAN Juxtaposed with another zinc finger protein 1 OS=Homo sapiens OX=9606 GN=JAZF1 PE=1 SV=2
20	Q49TU3	0.42	37.0	243	0.008	0.049	Q49TU3_DANRE JAZF zinc finger 1b OS=Danio rerio OX=7955 GN=zgc:103778 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307746

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349076	0.814	Atrophin-1
2	9606.ENSP00000384527	0.716	Zinc finger and BTB domain-containing protein 40
3	9606.ENSP00000253047	0.708	Transmembrane protein 160
4	9606.ENSP00000481850	0.694	Protein Jade-3
5	9606.ENSP00000426120	0.672	GRAM domain-containing protein 2B
6	9606.ENSP00000338217	0.659	Zinc finger protein 532
7	9606.ENSP00000264711	0.653	DnaJ homolog subfamily C member 27
8	9606.ENSP00000370508	0.653	Translation initiation factor IF-3, mitochondrial
9	9606.ENSP00000451000	0.649	Zinc finger and BTB domain-containing protein 1
10	9606.ENSP00000308759	0.639	Zinc finger and BTB domain-containing protein 21
11	9606.ENSP00000476119	0.636	Diphosphoinositol polyphosphate phosphohydrolase 1
12	9606.ENSP00000354414	0.618	Zinc finger protein 627
13	9606.ENSP00000300571	0.615	G-protein coupled receptor family C group 5 member B
14	9606.ENSP00000410216	0.610	Centrosomal protein POC5
15	9606.ENSP00000012049	0.607	Glutaminyl-peptide cyclotransferase-like protein
16	9606.ENSP00000420727	0.602	Zinc finger protein 181
17	9606.ENSP00000322251	0.601	Serine/threonine-protein kinase TNNI3K
18	9606.ENSP00000396857	0.600	Zinc finger protein 697
19	9606.ENSP00000426387	0.595	Zinc finger and BTB domain-containing protein 38
20	9606.ENSP00000291182	0.588	Zinc finger protein 235

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990841	0.343	promoter-specific chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0019222	0.975	regulation of metabolic process
GO:0009889	0.969	regulation of biosynthetic process
GO:0051252	0.968	regulation of RNA metabolic process
GO:0010468	0.965	regulation of gene expression
GO:0048523	0.960	negative regulation of cellular process
GO:0010556	0.943	regulation of macromolecule biosynthetic process
GO:0031326	0.943	regulation of cellular biosynthetic process
GO:0006355	0.884	regulation of DNA-templated transcription
GO:0002682	0.808	regulation of immune system process
GO:0030155	0.801	regulation of cell adhesion
GO:0050865	0.801	regulation of cell activation
GO:0006357	0.747	regulation of transcription by RNA polymerase II
GO:0051172	0.717	negative regulation of nitrogen compound metabolic process
GO:0031324	0.717	negative regulation of cellular metabolic process
GO:0045595	0.704	regulation of cell differentiation
GO:0010605	0.687	negative regulation of macromolecule metabolic process
GO:0060284	0.655	regulation of cell development
GO:0051249	0.648	regulation of lymphocyte activation
GO:1903706	0.648	regulation of hemopoiesis
GO:0050863	0.620	regulation of T cell activation
GO:1902105	0.620	regulation of leukocyte differentiation
GO:0022407	0.593	regulation of cell-cell adhesion
GO:0051253	0.508	negative regulation of RNA metabolic process
GO:0010558	0.472	negative regulation of macromolecule biosynthetic process
GO:0031327	0.472	negative regulation of cellular biosynthetic process
GO:0045892	0.444	negative regulation of DNA-templated transcription
GO:0009987	0.401	cellular process
GO:0000122	0.364	negative regulation of transcription by RNA polymerase II
GO:1903037	0.352	regulation of leukocyte cell-cell adhesion
GO:0045580	0.352	regulation of T cell differentiation
GO:0002683	0.308	negative regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.618	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]