StarFunc result for job id Q9ULE0

User Input

>input (1092 residues)
MDHINKLTQIEDPREQWRREQERMLKEYLIVAQEALNAKKEIYQIKQQRFELAQEEYQQL
HKMCEDDSRSYASSFSGYSTNTKYDPHQIKAEIASRRDRLSRLKRELTQMKQELQYKEKG
VETLQEIDRKMSSTHTSYKLDEAQAIMSELRTIKKAICTGEKERRDLMHSLAKLTDSFKN
SCSVTDSLVDFPHHVGVPGDAGVPQQFCDAGSQTDIIGEFVFDDKTRLVDRVRLNWQYEE
ARKRVANIQQQLARLDNESWPSTAEADRDRLQLIKEKEALLQELQLIIAQRRSAGDVARL
EEERERLEEELRRARATSAQGATERILLQEKRNCLLMQLEEATRLTSYLQSQLKSLCAST
LTVSSGSSRGSLASSRGSLASSRGSLSSVSFTDIYGLPQYEKPDAEGSQLLRFDLIPFDS
LGRDAPFSEPPGPSGFHKQRRSLDTPQSLASLSSRSSLSSLSPPSSPLDTPFLPASRDSP
LAQLADSCEGPGLGALDRLRAHASAMGDEDLPGMAALQPHGVPGDGEGPHERGPPPASAP
VGGTVTLREDSAKRLERRARRISACLSDYSLASDSGVFEPLTKRNEDAEEPAYGDTASNG
DPQIHVGLLRDSGSECLLVHVLQLKNPAGLAVKEDCKVHIRVYLPPLDSGTPNTYCSKAL
EFQVPLVFNEVFRIPVHSSALTLKSLQLYVCSVTPQLQEELLGIAQINLADYDSLSEMQL
RWHSVQVFTSSEPSRTREAGCAGESSARDPAHTISISGKTDAVTVLLARTTAQLQAVERE
LAEERAKLEYTEEEVLEMERKEEQAEAISERSWQADSVDSGCSNCTQTSPPYPEPCCMGI
DSILGHPFAAQAGPYSPEKFQPSPLKVDKETNTEDLFLEEAASLVKERPSRRARGSPFVR
SGTIVRSQTFSPGARSQYVCRLYRSDSDSSTLPRKSPFVRNTLERRTLRYKQSCRSSLAE
LMARTSLDLELDLQASRTRQRQLNEELCALRELRQRLEDAQLRGQTDLPPWVLRDERLRG
LLREAERQTRQTKLDYRHEQAAEKMLKKASKEIYQLRGQSHKEPIQVQTFREKIAFFTRP
RINIPPLPADDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULE0	1.000	1.000	0.000	1092	1.000	1.000	Q9ULE0.pdb.gz	WWC3_HUMAN Protein WWC3 OS=Homo sapiens OX=9606 GN=WWC3 PE=1 SV=3
2	AFDB:Q8IX03	0.437	0.429	1.171E-57	1113	0.417	0.409	Q8IX03.pdb.gz	KIBRA_HUMAN Protein KIBRA OS=Homo sapiens OX=9606 GN=WWC1 PE=1 SV=1
3	AFDB:Q6AWC2	0.311	0.288	2.347E-56	1192	0.437	0.400	Q6AWC2.pdb.gz	WWC2_HUMAN Protein WWC2 OS=Homo sapiens OX=9606 GN=WWC2 PE=1 SV=2
4	AFDB:E9QGC4	0.351	0.345	1.695E-50	1112	0.392	0.385	E9QGC4.pdb.gz	E9QGC4_DANRE Protein KIBRA OS=Danio rerio OX=7955 GN=wwc1 PE=4 SV=2
5	PDB:3pfqA	0.099	0.199	1.172E-5	523	0.021	0.044	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
6	AFDB:Q6XK20	0.109	0.108	6.863E-5	1102	0.064	0.064	Q6XK20.pdb.gz	Q6XK20_DROME Bitesize isoform 1 OS=Drosophila melanogaster OX=7227 GN=btsz PE=2 SV=1
7	AFDB:P41885	0.113	0.112	3.856E-4	1106	0.060	0.060	P41885.pdb.gz	RBF1_CAEEL Rabphilin-1 OS=Caenorhabditis elegans OX=6239 GN=rbf-1 PE=2 SV=2
8	PDB:1cjyA	0.079	0.133	1.582E-3	633	0.016	0.027	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
9	PDB:5izrC	0.076	0.122	9.735E-3	659	0.018	0.030	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
10	PDB:5ixcA	0.078	0.122	1.167E-2	684	0.020	0.032	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
11	PDB:5iz5B	0.073	0.103	1.222E-2	746	0.019	0.028	5iz5B.pdb.gz
12	AFDB:Q99K31	0.055	0.088	1.274E-2	616	0.055	0.097	Q99K31.pdb.gz	Q99K31_MOUSE Col6a3 protein (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
13	PDB:5a50A	0.062	0.379	1.278E-2	165	0.013	0.085	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
14	AFDB:Q4TZQ4	0.057	0.070	1.395E-2	831	0.090	0.118	Q4TZQ4.pdb.gz	Q4TZQ4_DROME TAK1-binding protein OS=Drosophila melanogaster OX=7227 GN=Tab2 PE=2 SV=1
15	PDB:5a52A	0.068	0.423	2.205E-2	154	0.011	0.078	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
16	PDB:5iz5A	0.075	0.106	3.318E-2	757	0.017	0.025	5iz5A.pdb.gz
17	AFDB:Q13625	0.060	0.059	4.149E-2	1128	0.118	0.114	Q13625.pdb.gz	ASPP2_HUMAN Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2
18	AFDB:A0A0B4KEU9	0.050	0.066	5.206E-2	804	0.120	0.163	A0A0B4KEU9.pdb.gz	A0A0B4KEU9_DROME Missing-in-metastasis, isoform K OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
19	PDB:1xo8A	0.063	0.280	5.226E-2	151	0.018	0.132	1xo8A.pdb.gz
20	PDB:5itdA	0.072	0.079	5.469E-2	995	0.024	0.026	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ULE0	0.0	2224	1092	1.000	1.000	WWC3_HUMAN Protein WWC3 OS=Homo sapiens OX=9606 GN=WWC3 PE=1 SV=3
2	E9QGC4	8.15e-107	362	1112	0.272	0.267	E9QGC4_DANRE Protein KIBRA OS=Danio rerio OX=7955 GN=wwc1 PE=4 SV=2
3	Q6AWC2	5.41e-105	358	1192	0.203	0.186	WWC2_HUMAN Protein WWC2 OS=Homo sapiens OX=9606 GN=WWC2 PE=1 SV=2
4	Q8IX03	1.77e-100	345	1113	0.200	0.196	KIBRA_HUMAN Protein KIBRA OS=Homo sapiens OX=9606 GN=WWC1 PE=1 SV=1
5	Q5SXA9	1.89e-96	333	1104	0.195	0.193	KIBRA_MOUSE Protein KIBRA OS=Mus musculus OX=10090 GN=Wwc1 PE=1 SV=1
6	Q9VFG8	6.74e-47	186	1288	0.137	0.116	KIBRA_DROME Protein kibra OS=Drosophila melanogaster OX=7227 GN=kibra PE=1 SV=2
7	F1M6U0	9.65e-19	94.7	1108	0.069	0.068	F1M6U0_RAT WW and C2 domain containing 1 OS=Rattus norvegicus OX=10116 GN=Wwc1 PE=1 SV=3
8	Q99N50	0.40	37.4	950	0.027	0.032	SYTL2_MOUSE Synaptotagmin-like protein 2 OS=Mus musculus OX=10090 GN=Sytl2 PE=1 SV=2
9	Q8N7C3	1.2	35.4	437	0.037	0.092	TRIMM_HUMAN Probable E3 ubiquitin-protein ligase TRIML2 OS=Homo sapiens OX=9606 GN=TRIML2 PE=1 SV=2
10	O76892	1.3	35.4	404	0.024	0.064	O76892_DROME EG:4F1.1 protein OS=Drosophila melanogaster OX=7227 GN=Scgdelta PE=2 SV=1
11	Q14BN4	3.3	34.3	828	0.036	0.047	SLMAP_HUMAN Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP PE=1 SV=1
12	Q7Z6P3	5.6	33.5	1021	0.038	0.040	RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens OX=9606 GN=RAB44 PE=1 SV=4
13	Q10491	6.4	33.5	928	0.024	0.028	SEC74_SCHPO Arf guanine nucleotide exchange factor sec74 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec74 PE=1 SV=2
14	Q5VT25	8.2	33.1	1732	0.032	0.020	MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens OX=9606 GN=CDC42BPA PE=1 SV=1
15	F4J1U4	8.4	33.1	1263	0.022	0.019	KN12E_ARATH Kinesin-like protein KIN-12E OS=Arabidopsis thaliana OX=3702 GN=KIN12E PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10358 NT-C2	4.2e+02	12.1	N-terminal C2 in EEIG1 and EHBP1 proteins
2	PF00792 PI3K_C2	4.8e+02	12.1	Phosphoinositide 3-kinase C2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370242

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355923	0.781	Tyrosine-protein phosphatase non-receptor type 14
2	9606.ENSP00000437550	0.768	Serine/threonine-protein kinase LATS1
3	9606.ENSP00000343899	0.763	FERM domain containing 6
4	9606.ENSP00000360147	0.736	Xaa-Pro aminopeptidase 2
5	9606.ENSP00000444957	0.724	AP-1 complex subunit sigma-2
6	9606.ENSP00000370299	0.706	Protein Shroom2
7	9606.ENSP00000429374	0.685	Ribosomal protein S20
8	9606.ENSP00000478927	0.668	Transcriptional coactivator YAP1
9	9606.ENSP00000372035	0.664	Serine/threonine-protein kinase LATS2
10	9606.ENSP00000384109	0.661	Cullin-4B
11	9606.ENSP00000390590	0.656	Dendrin
12	9606.ENSP00000283309	0.646	FERM domain containing 1
13	9606.ENSP00000344666	0.594	Merlin
14	9606.ENSP00000370010	0.592	Thymosin beta-4
15	9606.ENSP00000367705	0.579	BCL-6 corepressor
16	9606.ENSP00000445077	0.569	Putative eukaryotic translation initiation factor 2 subunit 3-like protein
17	9606.ENSP00000253039	0.566	Eukaryotic translation initiation factor 2 subunit 3
18	9606.ENSP00000348099	0.550	PDZ and LIM domain protein 7
19	9606.ENSP00000361892	0.535	Serine/threonine-protein kinase 4
20	9606.ENSP00000470381	0.521	Zinc finger protein 468

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0060090	1.000	molecular adaptor activity
GO:0019900	1.000	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009966	0.981	regulation of signal transduction
GO:0048585	0.961	negative regulation of response to stimulus
GO:1902531	0.959	regulation of intracellular signal transduction
GO:0060255	0.952	regulation of macromolecule metabolic process
GO:0051239	0.951	regulation of multicellular organismal process
GO:0051171	0.946	regulation of nitrogen compound metabolic process
GO:0040008	0.945	regulation of growth
GO:0080090	0.944	regulation of primary metabolic process
GO:0051093	0.944	negative regulation of developmental process
GO:0048523	0.944	negative regulation of cellular process
GO:0031323	0.943	regulation of cellular metabolic process
GO:0010468	0.937	regulation of gene expression
GO:0051241	0.890	negative regulation of multicellular organismal process
GO:0048638	0.889	regulation of developmental growth
GO:0035330	0.863	regulation of hippo signaling
GO:0010605	0.847	negative regulation of macromolecule metabolic process
GO:0031326	0.820	regulation of cellular biosynthetic process
GO:0010556	0.816	regulation of macromolecule biosynthetic process
GO:0009987	0.805	cellular process
GO:0046620	0.780	regulation of organ growth
GO:0045926	0.773	negative regulation of growth
GO:0051172	0.764	negative regulation of nitrogen compound metabolic process
GO:0006355	0.761	regulation of DNA-templated transcription
GO:0048640	0.720	negative regulation of developmental growth
GO:0023057	0.712	negative regulation of signaling
GO:0046621	0.664	negative regulation of organ growth
GO:0031324	0.663	negative regulation of cellular metabolic process
GO:0009968	0.655	negative regulation of signal transduction
GO:0045892	0.497	negative regulation of DNA-templated transcription
GO:1902532	0.481	negative regulation of intracellular signal transduction
GO:0006357	0.442	regulation of transcription by RNA polymerase II
GO:0000122	0.430	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.944	organelle
GO:0043227	0.830	membrane-bounded organelle
GO:0043229	0.830	intracellular organelle
GO:0005634	0.824	nucleus
GO:0016020	0.766	membrane
GO:0071944	0.727	cell periphery
GO:0005886	0.718	plasma membrane
GO:0070013	0.600	intracellular organelle lumen
GO:0031981	0.591	nuclear lumen
GO:0005654	0.509	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]