StarFunc result for job id Q9ULE3

User Input

>input (1009 residues)
MDMFSLDMIISDPAAEASRAGKKQLRGVQNPCPSARARPRHKSLNIKDKISEWEGKKEVP
TPAPSRRADGQEDYLPSSTVERRSSDGVRTQVTEAKNGMRPGTESTEKERNKGAVNVGGQ
DPEPGQDLSQPEREVDPSWGRGREPRLGKLRFQNDPLSVLKQVKKLEQALKDGSAGLDPQ
LPGTCYSPHCPPDKAEAGSTLPENLGGGSGSEVSQRVHPSDLEGREPTPELVEDRKGSCR
RPWDRSLENVYRGSEGSPTKPFINPLPKPRRTFKHAGEGDKDGKPGIGFRKEKRNLPPLP
SLPPPPLPSSPPPSSVNRRLWTGRQKSSADHRKSYEFEDLLQSSSESSRVDWYAQTKLGL
TRTLSEENVYEDILDPPMKENPYEDIELHGRCLGKKCVLNFPASPTSSIPDTLTKQSLSK
PAFFRQNSERRNFKLLDTRKLSRDGTGSPSKISPPSTPSSPDDIFFNLGDPQNGRKKRKI
PKLVLRINAIYEVRRGKKRVKRLSQSMESNSGKVTDENSESDSDTEEKLKAHSQRLVNVK
SRLKQAPRYPSLARELIEYQERQLFEYFVVVSLHKKQAGAAYVPELTQQFPLKLERSFKF
MREAEDQLKAIPQFCFPDAKDWVPVQQFTSETFSFVLTGEDGSRRFGYCRRLLPGGKGKR
LPEVYCIVSRLGCFSLFSRILDEVEKRRGISPALVQPLMRSVMEAPFPALGKTILVKNFL
PGSGTEVIELCRPLDSRLEHVDFESLFSSLSVRHLVCVFASLLLERRVIFIADKLSILSK
CCHAMVALIYPFAWQHTYIPVLPPAMVDIVCSPTPFLIGLLSSSLPLLRELPLEEVLVVD
LVNSRFLRQMDDEDSILPRKLQVALEHILEQRNELACEQDEGPLDGRHGPESSPLNEVVS
EAFVRFFVEIVGHYSLFLTSGEREERTLQREAFRKAVSSKSLRHFLEVFMETQMFRGFIQ
ERELRRQDAKGLFEVRAQEYLETLPSGEHSGVNKFLKGLGNKMKFLHKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULE3	1.000	1.000	0.000	1009	1.000	1.000	Q9ULE3.pdb.gz	DEN2A_HUMAN DENN domain-containing protein 2A OS=Homo sapiens OX=9606 GN=DENND2A PE=1 SV=4
2	AFDB:P78524	0.520	0.464	1.311E-82	1137	0.508	0.451	P78524.pdb.gz	DEN2B_HUMAN DENN domain-containing protein 2B OS=Homo sapiens OX=9606 GN=DENND2B PE=1 SV=3
3	AFDB:Q9H6A0	0.397	0.837	2.203E-50	471	0.210	0.450	Q9H6A0.pdb.gz	DEN2D_HUMAN DENN domain-containing protein 2D OS=Homo sapiens OX=9606 GN=DENND2D PE=1 SV=2
4	AFDB:Q8TEH3	0.342	0.342	2.945E-14	1009	0.123	0.123	Q8TEH3.pdb.gz	DEN1A_HUMAN DENN domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2
5	AFDB:Q8K382	0.342	0.340	2.360E-13	1016	0.119	0.118	Q8K382.pdb.gz	DEN1A_MOUSE DENN domain-containing protein 1A OS=Mus musculus OX=10090 GN=Dennd1a PE=1 SV=2
6	AFDB:Q7Z401	0.315	0.178	2.599E-8	1863	0.101	0.055	Q7Z401.pdb.gz	MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2
7	PDB:6nzdH	0.111	0.244	9.011E-6	387	0.051	0.132	6nzdH.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
8	PDB:7mgeC	0.129	0.273	2.694E-5	365	0.042	0.115	7mgeC.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
9	PDB:6ulgL	0.123	0.226	2.998E-4	458	0.052	0.114	6ulgL.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
10	PDB:8dhbJ	0.123	0.285	4.164E-4	361	0.044	0.122	8dhbJ.pdb.gz	Structural basis for FLCN RagC GAP activation in MiT-TFE substrate-selective mTORC1 regulation.
11	PDB:6lt0B	0.111	0.241	8.487E-4	386	0.059	0.155	6lt0B.pdb.gz
12	AFDB:Q7Z333	0.072	0.043	4.436E-3	2677	0.159	0.060	Q7Z333.pdb.gz	SETX_HUMAN Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX PE=1 SV=4
13	PDB:6lt0C	0.119	0.240	5.769E-3	385	0.048	0.125	6lt0C.pdb.gz
14	AFDB:A2AKX3	0.056	0.032	7.671E-3	2646	0.141	0.054	A2AKX3.pdb.gz	SETX_MOUSE Probable helicase senataxin OS=Mus musculus OX=10090 GN=Setx PE=1 SV=1
15	PDB:7o2wA	0.140	0.276	8.465E-3	418	0.049	0.117	7o2wA.pdb.gz
16	PDB:7mgeB	0.087	0.176	9.976E-3	442	0.061	0.140	7mgeB.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
17	PDB:7o2wB	0.099	0.199	1.725E-2	422	0.033	0.078	7o2wB.pdb.gz
18	AFDB:Q54I36	0.049	0.043	2.293E-2	1338	0.099	0.075	Q54I36.pdb.gz	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
19	PDB:6fwrA	0.079	0.109	7.993E-2	699	0.028	0.040	6fwrA.pdb.gz	DNA translocation mechanism of an XPD family helicase.
20	AFDB:Q9HFF4	0.047	0.047	1.122E-1	1023	0.097	0.096	Q9HFF4.pdb.gz	PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P78524	0.0	782	1137	0.502	0.446	DEN2B_HUMAN DENN domain-containing protein 2B OS=Homo sapiens OX=9606 GN=DENND2B PE=1 SV=3
2	Q68D51	0.0	734	928	0.450	0.489	DEN2C_HUMAN DENN domain-containing protein 2C OS=Homo sapiens OX=9606 GN=DENND2C PE=1 SV=2
3	Q9ULE3	0.0	2050	1009	1.000	1.000	DEN2A_HUMAN DENN domain-containing protein 2A OS=Homo sapiens OX=9606 GN=DENND2A PE=1 SV=4
4	Q9H6A0	1.74e-123	386	471	0.202	0.433	DEN2D_HUMAN DENN domain-containing protein 2D OS=Homo sapiens OX=9606 GN=DENND2D PE=1 SV=2
5	Q8TEH3	5.96e-44	175	1009	0.127	0.127	DEN1A_HUMAN DENN domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2
6	A0A0A0MS48	7.44e-44	175	1070	0.127	0.120	A0A0A0MS48_HUMAN DENN domain containing 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2
7	Q8K382	1.52e-43	174	1016	0.126	0.125	DEN1A_MOUSE DENN domain-containing protein 1A OS=Mus musculus OX=10090 GN=Dennd1a PE=1 SV=2
8	Q3U1T9	4.17e-39	159	766	0.113	0.149	DEN1B_MOUSE DENN domain-containing protein 1B OS=Mus musculus OX=10090 GN=Dennd1b PE=1 SV=3
9	Q6P3S1	1.31e-37	154	775	0.118	0.154	DEN1B_HUMAN DENN domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DENND1B PE=1 SV=2
10	Q8IV53	7.03e-33	139	801	0.118	0.149	DEN1C_HUMAN DENN domain-containing protein 1C OS=Homo sapiens OX=9606 GN=DENND1C PE=1 SV=1
11	G5ECW9	1.63e-21	102	661	0.084	0.129	G5ECW9_CAEEL UDENN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rme-4 PE=1 SV=1
12	Q5VZ89	1.59e-17	90.9	1909	0.098	0.052	DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3
13	O75064	4.02e-17	89.7	1496	0.095	0.064	DEN4B_HUMAN DENN domain-containing protein 4B OS=Homo sapiens OX=9606 GN=DENND4B PE=1 SV=4
14	Q7Z401	1.54e-16	87.8	1863	0.100	0.054	MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2
15	Q9W3D3	2.41e-14	80.5	1671	0.085	0.051	CRAG_DROME DENN domain-containing protein Crag OS=Drosophila melanogaster OX=7227 GN=Crag PE=1 SV=3
16	Q9VGH9	4.89e-14	79.7	1993	0.036	0.018	Q9VGH9_DROME SET domain binding factor, isoform A OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=3
17	Q7KSP6	4.96e-14	79.7	1973	0.036	0.018	Q7KSP6_DROME SET domain binding factor, isoform B OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=1
18	A6H8H2	6.09e-14	79.3	1906	0.092	0.049	DEN4C_MOUSE DENN domain-containing protein 4C OS=Mus musculus OX=10090 GN=Dennd4c PE=1 SV=1
19	Q8RXA7	1.05e-13	78.2	1187	0.085	0.072	SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana OX=3702 GN=SCD1 PE=1 SV=1
20	O02626	1.09e-13	78.2	1409	0.085	0.061	MADD_CAEEL MAP kinase-activating death domain protein OS=Caenorhabditis elegans OX=6239 GN=aex-3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03455 dDENN	9.4e-09	46.5	dDENN domain
2	PF02141 DENN	1e-52	190.3	DENN (AEX-3) domain
3	PF08616 SPA	3.2e+02	12.7	Stabilization of polarity axis
4	PF07531 TAFH	75	14.8	NHR1 homology to TAF
5	PF03456 uDENN	1.3e-10	52.9	uDENN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000275884

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000243298	0.964	Ras-related protein Rab-9B
2	9606.ENSP00000420127	0.951	Ras-related protein Rab-9A
3	9606.ENSP00000350386	0.910	Rab proteins geranylgeranyltransferase component A 1
4	9606.ENSP00000355511	0.910	Rab proteins geranylgeranyltransferase component A 2
5	9606.ENSP00000369538	0.901	Rab GDP dissociation inhibitor beta
6	9606.ENSP00000394071	0.901	Rab GDP dissociation inhibitor alpha
7	9606.ENSP00000418575	0.599	Protein FAM19A1
8	9606.ENSP00000369318	0.564	Rho-related BTB domain-containing protein 3
9	9606.ENSP00000481850	0.557	Protein Jade-3
10	9606.ENSP00000253669	0.506	HAUS augmin-like complex subunit 8
11	9606.ENSP00000409924	0.504	PTGES3L-AARSD1 readthrough
12	9606.ENSP00000400870	0.503	Alanyl-tRNA editing protein Aarsd1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0046907	0.993	intracellular transport
GO:0016197	0.982	endosomal transport
GO:0016482	0.959	cytosolic transport
GO:0042147	0.888	retrograde transport, endosome to Golgi
GO:0065007	0.596	biological regulation
GO:0050789	0.576	regulation of biological process
GO:0050794	0.572	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005829	1.000	cytosol
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0005856	0.887	cytoskeleton
GO:0015629	0.871	actin cytoskeleton
GO:0043227	0.847	membrane-bounded organelle
GO:0043231	0.841	intracellular membrane-bounded organelle
GO:0016020	0.407	membrane
GO:0005634	0.395	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]