StarFunc result for job id Q9ULE4

User Input

>input (1060 residues)
MASALNSKINPPGTCQGSKADGGAGWRMDCDPQMHVKMCKKIAQLTKVIYALNTRQDEAE
ASMEALREAHQEELQNAVAETKARLLQEQGCAEEEALLQRIQALESALELQKRLTEEALA
ESASCRLETKERELRVEAEHAERVLTLSREMLELKADYERRLQHLTSHEATPQGRLPQES
PETKSEPGQGPEMQEVLLEVQRLRVENQQLSKDYARKAEELQATYERENEAIRQAMQQSV
SQALWQWQEKESDLRKNFQVQESALQAQVRKLEGDLEHRGRKISDLKKYAQKLKERIQDL
DVQLKEARQENSELKGTAKKLGEKLAVAKDRMMLQECRGTQQTDAMKTELVSENKVLREE
NDLEAGNLHPQQDQSCLKECPCMKGGTDMQTKKEASAETEYMKQQYEEDLRKIKHQTEEE
KKHLKDQLVKRLEDLVKKHTVEIKSVRSSVEAERKKLQREVEAQLEEVRKKSEKEIKQLE
EEKAALNVKLQNSLLEVLRLEEFIQQNKTRPTGAEESPQELGRQHCSILETQDPCLKLDE
TSPRGEEYQDKLAAEEGTSSDEEERTKVLLKEGSDPQPPLGSLLKEKTSKIQRLEEDWQS
QKAKLQAQVSQMQQALEQCTSNYREDLQALKQLSDLEREKLQRELQETTQQNHAMKAQLE
ASHQRALRMLEKARHQELKATEERLKKESSHSLQIQHQTHRLELQALEEKARQELQEERE
RMQAQQALLLESLRQELSEQQAACSGHQKDLEALQAELRALGRQQASSQCPGDSKDHIIA
TEERGGPGQAGSPPGAAGQGSGEGCGLWEENAQLQDAVRRLRAEVEQHQQEAQKLRDQRR
FLEETQQAQRAREVETLRQEHRKEMQAMVADFSSAQAQLQARLAALEAELKDSGEKPGKG
ASRPEDLQLIGRLQTRLKEREDIIKQLTEERRFHYAAFPSAMSHRNRSFSFNPHPGYLTP
SMKKKKVEDVPSRVVSVPNLASYAKNFLSGDLSSRINAPPITTSPSLDPSPSCGRTYKPN
QSTDAKTATRTPDGETAQAKEVQQKQGSPHQEWFTKYFSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NB25	0.126	0.118	4.016E-16	1140	0.282	0.262	Q8NB25.pdb.gz	F184A_HUMAN Protein FAM184A OS=Homo sapiens OX=9606 GN=FAM184A PE=1 SV=3
2	AFDB:Q9VZT7	0.101	0.079	5.637E-5	1381	0.176	0.135	Q9VZT7.pdb.gz	Q9VZT7_DROME Girdin, isoform A OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
3	AFDB:Q5VU43	0.088	0.043	9.547E-5	2346	0.175	0.079	Q5VU43.pdb.gz	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
4	AFDB:Q8IR55	0.091	0.051	2.027E-4	2567	0.189	0.078	Q8IR55.pdb.gz	Q8IR55_DROME Mushroom body defect, isoform H OS=Drosophila melanogaster OX=7227 GN=mud PE=1 SV=3
5	AFDB:A0A2R8QCI3	0.119	0.069	5.001E-4	2023	0.173	0.090	A0A2R8QCI3.pdb.gz	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1
6	AFDB:O94964	0.066	0.053	6.268E-4	1423	0.160	0.119	O94964.pdb.gz	SOGA1_HUMAN Protein SOGA1 OS=Homo sapiens OX=9606 GN=SOGA1 PE=1 SV=2
7	AFDB:Q9P219	0.100	0.056	6.758E-4	2028	0.183	0.096	Q9P219.pdb.gz	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
8	AFDB:Q57W72	0.088	0.118	7.286E-4	737	0.085	0.122	Q57W72.pdb.gz	Q57W72_TRYB2 Bilobe protein, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28F14.420 PE=4 SV=1
9	AFDB:Q6P5H2	0.129	0.082	7.856E-4	1864	0.193	0.110	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
10	AFDB:Q9WUJ3	0.083	0.040	1.145E-3	2324	0.191	0.087	Q9WUJ3.pdb.gz	MYOME_RAT Myomegalin OS=Rattus norvegicus OX=10116 GN=Pde4dip PE=1 SV=1
11	PDB:7pubCI	0.032	0.073	8.878E-1	427	0.029	0.073	7pubCI.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
12	PDB:6u424R	0.088	0.227	2.191	366	0.049	0.142	6u424R.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NB25	8.98e-72	262	1140	0.313	0.291	F184A_HUMAN Protein FAM184A OS=Homo sapiens OX=9606 GN=FAM184A PE=1 SV=3
2	Q6P9G8	1.08e-69	255	1107	0.306	0.293	Q6P9G8_HUMAN Family with sequence similarity 184, member A OS=Homo sapiens OX=9606 GN=FAM184A PE=1 SV=2
3	Q38E32	4.77e-05	50.1	985	0.020	0.021	Q38E32_TRYB2 Protein FAM184A/B N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1230 PE=4 SV=1
4	Q9UKX2	3.4	34.3	1941	0.059	0.032	MYH2_HUMAN Myosin-2 OS=Homo sapiens OX=9606 GN=MYH2 PE=1 SV=1
5	Q4U0S2	4.2	33.9	1974	0.028	0.015	Q4U0S2_DANRE Myosin-11 OS=Danio rerio OX=7955 GN=myh11 PE=1 SV=1
6	D4ABV2	7.0	33.1	1006	0.092	0.097	D4ABV2_RAT Centrosomal protein 112 OS=Rattus norvegicus OX=10116 GN=Cep112 PE=4 SV=4
7	R4GDZ5	8.4	33.1	1938	0.027	0.015	R4GDZ5_DANRE Myosin, heavy chain 7B, cardiac muscle, beta a OS=Danio rerio OX=7955 GN=myh7b PE=1 SV=3
8	G3UW82	8.9	32.7	1942	0.058	0.032	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
9	B8QI33	9.3	32.7	1267	0.027	0.023	B8QI33_MOUSE Liprin-alpha 1 OS=Mus musculus OX=10090 GN=Ppfia1 PE=2 SV=1
10	B2RXQ2	9.4	32.7	1266	0.027	0.023	B2RXQ2_MOUSE Ppfia1 protein OS=Mus musculus OX=10090 GN=Ppfia1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15665 FAM184	3.1e-23	94.2	Family with sequence similarity 184, A and B
2	PF04568 IATP	14	17.5	Mitochondrial ATPase inhibitor, IATP

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265018

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371682	0.830	DDB1- and CUL4-associated factor 16
2	9606.ENSP00000371661	0.753	Ligand-dependent nuclear receptor corepressor-like protein
3	9606.ENSP00000423881	0.716	PACRG-like protein
4	9606.ENSP00000251496	0.697	Condensin complex subunit 3
5	9606.ENSP00000337991	0.666	Protein SPT2 homolog
6	9606.ENSP00000358512	0.625	Protein mab-21-like 3
7	9606.ENSP00000304192	0.610	Pecanex-like protein 1
8	9606.ENSP00000427820	0.590	Uncharacterized protein C8orf34
9	9606.ENSP00000371587	0.555	Kv channel-interacting protein 4
10	9606.ENSP00000296424	0.551	3-hydroxybutyrate dehydrogenase type 2
11	9606.ENSP00000371212	0.550	RNA-binding protein 47
12	9606.ENSP00000440440	0.547	Activating transcription factor 7-interacting protein 1
13	9606.ENSP00000276570	0.544	DnaJ heat shock protein family member C5 beta
14	9606.ENSP00000369755	0.544	C2 calcium-dependent domain-containing protein 4B
15	9606.ENSP00000237380	0.530	Mediator of RNA polymerase II transcription subunit 28
16	9606.ENSP00000242315	0.525	PHD finger protein 24
17	9606.ENSP00000227525	0.521	Transmembrane protein 109
18	9606.ENSP00000281243	0.505	Dihydropteridine reductase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.963	cellular process
GO:0065007	0.889	biological regulation
GO:0050789	0.873	regulation of biological process
GO:0050794	0.816	regulation of cellular process
GO:0071840	0.596	cellular component organization or biogenesis
GO:0016043	0.582	cellular component organization
GO:0006996	0.369	organelle organization
GO:0048518	0.348	positive regulation of biological process
GO:0000226	0.331	microtubule cytoskeleton organization
GO:0031023	0.306	microtubule organizing center organization
GO:0098534	0.304	centriole assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043229	0.998	intracellular organelle
GO:0005829	0.983	cytosol
GO:0031981	0.965	nuclear lumen
GO:0005654	0.952	nucleoplasm
GO:0043228	0.892	non-membrane-bounded organelle
GO:0043232	0.883	intracellular non-membrane-bounded organelle
GO:0005576	0.408	extracellular region
GO:0005615	0.381	extracellular space
GO:0015630	0.344	microtubule cytoskeleton
GO:0005815	0.310	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]