StarFunc result for job id Q9ULG1

User Input

>input (1556 residues)
MASELGARDDGGCTELAKPLYLQYLERALRLDHFLRQTSAIFNRNISSDDSEDGLDDSNP
LLPQSGDPLIQVKEEPPNSLLGETSGAGSSGMLNTYSLNGVLQSESKCDKGNLYNFSKLK
KSRKWLKSILLSDESSEADSQSEDDDEEELNLSREELHNMLRLHKYKKLHQNKYSKDKEL
QQYQYYSAGLLSTYDPFYEQQRHLLGPKKKKFKEEKKLKAKLKKVKKKRRRDEELSSEES
PRRHHHQTKVFAKFSHDAPPPGTKKKHLSIEQLNARRRKVWLSIVKKELPKANKQKASAR
NLFLTNSRKLAHQCMKEVRRAALQAQKNCKETLPRARRLTKEMLLYWKKYEKVEKEHRKR
AEKEALEQRKLDEEMREAKRQQRKLNFLITQTELYAHFMSRKRDMGHDGIQEEILRKLED
SSTQRQIDIGGGVVVNITQEDYDSNHFKAQALKNAENAYHIHQARTRSFDEDAKESRAAA
LRAANKSGTGFGESYSLANPSIRAGEDIPQPTIFNGKLKGYQLKGMNWLANLYEQGINGI
LADEMGLGKTVQSIALLAHLAERENIWGPFLIISPASTLNNWHQEFTRFVPKFKVLPYWG
NPHDRKVIRRFWSQKTLYTQDAPFHVVITSYQLVVQDVKYFQRVKWQYMVLDEAQALKSS
SSVRWKILLQFQCRNRLLLTGTPIQNTMAELWALLHFIMPTLFDSHEEFNEWFSKDIESH
AENKSAIDENQLSRLHMILKPFMLRRIKKDVENELSDKIEILMYCQLTSRQKLLYQALKN
KISIEDLLQSSMGSTQQAQNTTSSLMNLVMQFRKVCNHPELFERQETWSPFHISLKPYHI
SKFIYRHGQIRVFNHSRDRWLRVLSPFAPDYIQRSLFHRKGINEESCFSFLRFIDISPAE
MANLMLQGLLARWLALFLSLKASYRLHQLRSWGAPEGESHQRYLRNKDFLLGVNFPLSFP
NLCSCPLLKSLVFSSHCKAVSGYSDQVVHQRRSATSSLRRCLLTELPSFLCVASPRVTAV
PLDSYCNDRSAEYERRVLKEGGSLAAKQCLLNGAPELAADWLNRRSQFFPEPAGGLWSIR
PQNGWSFIRIPGKESLITDSGKLYALDVLLTRLKSQGHRVLIYSQMTRMIDLLEEYMVYR
KHTYMRLDGSSKISERRDMVADFQNRNDIFVFLLSTRAGGLGINLTAADTVIFYDSDWNP
TVDQQAMDRAHRLGQTKQVTVYRLICKGTIEERILQRAKEKSEIQRMVISGGNFKPDTLK
PKEVVSLLLDDEELEKKLRLRQEEKRQQEETNRVKERKRKREKYAEKKKKEDELDGKRRK
EGVNLVIPFVPSADNSNLSADGDDSFISVDSAMPSPFSEISISSELHTGSIPLDESSSDM
LVIVDDPASSAPQSRATNSPASITGSVSDTVNGISIQEMPAAGRGHSARSRGRPKGSGST
AKGAGKGRSRKSTAGSAAAMAGAKAGAAAASAAAYAAYGYNVSKGISASSPLQTSLVRPA
GLADFGPSSASSPLSSPLSKGNNVPGNPKNLHMTSSLAPDSLVRKQGKGTNPSGGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZPV2	0.819	0.817	0.000	1559	0.969	0.967	Q6ZPV2.pdb.gz	INO80_MOUSE Chromatin-remodeling ATPase INO80 OS=Mus musculus OX=10090 GN=Ino80 PE=1 SV=2
2	AFDB:Q60EX7	0.295	0.403	2.404E-47	1128	0.204	0.282	Q60EX7.pdb.gz	CHR19_ORYSJ Probable ATP-dependent DNA helicase CHR719 OS=Oryza sativa subsp. japonica OX=39947 GN=CHR719 PE=1 SV=1
3	PDB:6gejM	0.287	0.621	8.768E-42	688	0.165	0.374	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
4	AFDB:Q7KU24	0.283	0.235	5.001E-38	1883	0.184	0.152	Q7KU24.pdb.gz	CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Chd1 PE=1 SV=1
5	AFDB:Q9US25	0.289	0.327	4.702E-36	1373	0.147	0.167	Q9US25.pdb.gz	HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hrp1 PE=1 SV=1
6	PDB:6jylK	0.272	0.812	1.171E-34	504	0.134	0.413	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
7	PDB:6tdaS	0.264	0.514	9.649E-32	783	0.157	0.312	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
8	PDB:7oo3b	0.274	0.774	1.015E-31	534	0.114	0.331	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
9	AFDB:Q9FNI6	0.263	0.387	2.433E-31	1029	0.118	0.178	Q9FNI6.pdb.gz	SM3L2_ARATH DNA repair protein RAD5A OS=Arabidopsis thaliana OX=3702 GN=RAD5A PE=1 SV=1
10	PDB:6g0lM	0.263	0.469	7.646E-31	855	0.130	0.237	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
11	AFDB:A0A0P0WGX7	0.285	0.444	2.745E-30	987	0.127	0.200	A0A0P0WGX7.pdb.gz	ENL1_ORYSJ SNF2 domain-containing protein ENL1 OS=Oryza sativa subsp. japonica OX=39947 GN=ENL1 PE=2 SV=1
12	PDB:7epuB	0.189	0.338	4.475E-30	748	0.141	0.293	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
13	PDB:6uxwA	0.271	0.525	1.056E-29	778	0.154	0.308	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
14	PDB:6g0lW	0.246	0.429	1.503E-29	878	0.127	0.224	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
15	PDB:6kw3Y	0.270	0.736	1.303E-26	548	0.136	0.385	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
16	PDB:5vvrM	0.253	0.728	2.890E-24	503	0.097	0.300	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
17	AFDB:Q387H5	0.272	0.419	1.405E-23	984	0.100	0.159	Q387H5.pdb.gz	Q387H5_TRYB2 DNA repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0400 PE=4 SV=1
18	AFDB:Q5FWF4	0.247	0.351	1.719E-23	1079	0.105	0.151	Q5FWF4.pdb.gz	ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens OX=9606 GN=ZRANB3 PE=1 SV=2
19	AFDB:Q9VMX6	0.223	0.448	3.115E-21	755	0.095	0.196	Q9VMX6.pdb.gz	SMAL1_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Drosophila melanogaster OX=7227 GN=Marcal1 PE=1 SV=2
20	AFDB:H7BYI2	0.218	0.416	2.701E-18	796	0.084	0.163	H7BYI2.pdb.gz	H7BYI2_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCAL1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F4J277	0.0	813	1540	0.305	0.308	F4J277_ARATH Chromatin-remodeling ATPase INO80 OS=Arabidopsis thaliana OX=3702 GN=INO80 PE=1 SV=1
2	O14148	0.0	853	1604	0.318	0.309	INO80_SCHPO Chromatin-remodeling ATPase INO80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ino80 PE=1 SV=4
3	Q6ZPV2	0.0	3122	1559	0.970	0.969	INO80_MOUSE Chromatin-remodeling ATPase INO80 OS=Mus musculus OX=10090 GN=Ino80 PE=1 SV=2
4	Q9ULG1	0.0	3225	1556	1.000	1.000	INO80_HUMAN Chromatin-remodeling ATPase INO80 OS=Homo sapiens OX=9606 GN=INO80 PE=1 SV=2
5	Q9VDY1	0.0	1066	1638	0.374	0.355	INO80_DROME Chromatin-remodeling ATPase INO80 OS=Drosophila melanogaster OX=7227 GN=Ino80 PE=1 SV=2
6	P53115	5.13e-175	567	1489	0.186	0.195	INO80_YEAST Chromatin-remodeling ATPase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INO80 PE=1 SV=1
7	Q9NDJ2	1.42e-91	333	3198	0.097	0.047	DOM_DROME Helicase domino OS=Drosophila melanogaster OX=7227 GN=dom PE=1 SV=2
8	Q6ZRS2	1.84e-90	329	3230	0.098	0.047	SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens OX=9606 GN=SRCAP PE=1 SV=3
9	Q9NEL2	5.01e-90	327	2395	0.094	0.061	SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans OX=6239 GN=ssl-1 PE=2 SV=4
10	Q7X9V2	5.74e-88	320	2055	0.093	0.071	PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana OX=3702 GN=PIE1 PE=1 SV=1
11	Q05471	3.05e-87	317	1514	0.101	0.104	SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWR1 PE=1 SV=1
12	O13682	1.31e-85	310	1288	0.103	0.125	SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swr1 PE=3 SV=1
13	Q383K6	1.90e-76	281	1211	0.087	0.111	Q383K6_TRYB2 SNF2 DNA repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2500 PE=4 SV=1
14	Q9XFH4	7.52e-75	268	764	0.114	0.232	DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana OX=3702 GN=DDM1 PE=1 SV=1
15	O94421	2.14e-74	276	1680	0.096	0.089	SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snf22 PE=1 SV=2
16	F4JAV9	7.41e-73	268	1057	0.085	0.126	F4JAV9_ARATH Chromatin-remodeling protein 11 OS=Arabidopsis thaliana OX=3702 GN=CHR11 PE=1 SV=1
17	Q8RWY3	8.78e-73	267	1056	0.085	0.126	ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana OX=3702 GN=CHR11 PE=1 SV=4
18	F4JY24	1.49e-72	267	1069	0.086	0.125	CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana OX=3702 GN=CHR17 PE=1 SV=1
19	F4JY25	1.54e-72	267	1072	0.086	0.125	F4JY25_ARATH Chromatin remodeling factor17 OS=Arabidopsis thaliana OX=3702 GN=CHR17 PE=1 SV=1
20	Q9UTN6	4.54e-72	267	1199	0.086	0.112	SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snf21 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13892 DBINO	3.9e-43	158.5	DNA-binding domain
2	PF11496 HDA2-3	0.25	22.1	Class II histone deacetylase complex subunits 2 and 3
3	PF00271 Helicase_C	2.3e-14	65.1	Helicase conserved C-terminal domain
4	PF04851 ResIII	0.037	25.5	Type III restriction enzyme, res subunit
5	PF00176 SNF2-rel_dom	4.6e-67	237.8	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355205

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000243903	0.999	Actin-related protein 5
2	9606.ENSP00000318297	0.999	RuvB-like 1
3	9606.ENSP00000336842	0.999	Actin-related protein 8
4	9606.ENSP00000473172	0.999	RuvB-like 2
5	9606.ENSP00000233331	0.998	INO80 complex subunit B
6	9606.ENSP00000391457	0.998	Chromosome 18 open reading frame 37, isoform CRA_a
7	9606.ENSP00000397552	0.996	Actin-like protein 6A
8	9606.ENSP00000436926	0.995	Nuclear factor related to kappa-B-binding protein
9	9606.ENSP00000457016	0.992	INO80 complex subunit E
10	9606.ENSP00000467041	0.992	Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair
11	9606.ENSP00000262238	0.988	Transcriptional repressor protein YY1
12	9606.ENSP00000356425	0.987	Ubiquitin carboxyl-terminal hydrolase isozyme L5
13	9606.ENSP00000349640	0.975	Microspherule protein 1
14	9606.ENSP00000352925	0.967	Transformation/transcription domain-associated protein
15	9606.ENSP00000374213	0.963	E1A-binding protein p400
16	9606.ENSP00000340330	0.947	Histone acetyltransferase KAT5
17	9606.ENSP00000375639	0.946	TCF3 fusion partner
18	9606.ENSP00000384198	0.934	INO80 complex subunit D
19	9606.ENSP00000301764	0.926	DNA damage-binding protein 1
20	9606.ENSP00000349960	0.926	Actin, cytoplasmic 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008094	1.000	ATP-dependent activity, acting on DNA
GO:0003677	0.998	DNA binding
GO:0043014	0.991	alpha-tubulin binding
GO:0016787	0.710	hydrolase activity
GO:0017111	0.638	ribonucleoside triphosphate phosphatase activity
GO:0004386	0.545	helicase activity
GO:0016887	0.478	ATP hydrolysis activity
GO:0003682	0.438	chromatin binding
GO:0140030	0.379	modification-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0044238	0.996	primary metabolic process
GO:0050794	0.996	regulation of cellular process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0080090	0.992	regulation of primary metabolic process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0051171	0.992	regulation of nitrogen compound metabolic process
GO:0031323	0.992	regulation of cellular metabolic process
GO:0048518	0.988	positive regulation of biological process
GO:0019219	0.980	regulation of nucleobase-containing compound metabolic process
GO:0009893	0.979	positive regulation of metabolic process
GO:0048522	0.976	positive regulation of cellular process
GO:0010604	0.974	positive regulation of macromolecule metabolic process
GO:0051173	0.967	positive regulation of nitrogen compound metabolic process
GO:0071840	0.961	cellular component organization or biogenesis
GO:0045935	0.957	positive regulation of nucleobase-containing compound metabolic process
GO:0044237	0.948	cellular metabolic process
GO:0016043	0.946	cellular component organization
GO:0090304	0.911	nucleic acid metabolic process
GO:0006259	0.901	DNA metabolic process
GO:0051052	0.852	regulation of DNA metabolic process
GO:0051276	0.839	chromosome organization
GO:0033044	0.826	regulation of chromosome organization
GO:0010468	0.751	regulation of gene expression
GO:0051054	0.702	positive regulation of DNA metabolic process
GO:0009889	0.672	regulation of biosynthetic process
GO:0031326	0.611	regulation of cellular biosynthetic process
GO:0010556	0.609	regulation of macromolecule biosynthetic process
GO:0051252	0.585	regulation of RNA metabolic process
GO:0050896	0.580	response to stimulus
GO:2001141	0.569	regulation of RNA biosynthetic process
GO:0006355	0.555	regulation of DNA-templated transcription
GO:0048583	0.530	regulation of response to stimulus
GO:2001020	0.518	regulation of response to DNA damage stimulus
GO:0006325	0.513	chromatin organization
GO:0051726	0.506	regulation of cell cycle
GO:0006338	0.472	chromatin remodeling
GO:0051716	0.463	cellular response to stimulus
GO:0009891	0.445	positive regulation of biosynthetic process
GO:0031328	0.434	positive regulation of cellular biosynthetic process
GO:0019538	0.418	protein metabolic process
GO:1902680	0.417	positive regulation of RNA biosynthetic process
GO:1903508	0.413	positive regulation of nucleic acid-templated transcription
GO:0043412	0.409	macromolecule modification
GO:0051130	0.406	positive regulation of cellular component organization
GO:0036211	0.402	protein modification process
GO:0045893	0.393	positive regulation of DNA-templated transcription
GO:0048519	0.328	negative regulation of biological process
GO:0006950	0.317	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.998	cytosol
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0032991	0.982	protein-containing complex
GO:0005694	0.931	chromosome
GO:1902494	0.870	catalytic complex
GO:0140513	0.870	nuclear protein-containing complex
GO:0016604	0.866	nuclear body
GO:0000785	0.844	chromatin
GO:0070603	0.614	SWI/SNF superfamily-type complex
GO:0000228	0.561	nuclear chromosome
GO:0097346	0.451	INO80-type complex
GO:0031011	0.349	Ino80 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.710	Hydrolases.
RHEA:23680	0.638	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.638	nucleoside-triphosphate phosphatase.
RHEA:13065	0.478	ATP + H2O = ADP + H(+) + phosphate

[back to server]