StarFunc result for job id Q9ULH0

User Input

>input (1771 residues)
MSVLISQSVINYVEEENIPALKALLEKCKDVDERNECGQTPLMIAAEQGNLEIVKELIKN
GANCNLEDLDNWTALISASKEGHVHIVEELLKCGVNLEHRDMGGWTALMWACYKGRTDVV
ELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVHLLLQNGAKVNCSDKYGTTPLVWAARK
GHLECVKHLLAMGADVDQEGANSMTALIVAVKGGYTQSVKEILKRNPNVNLTDKDGNTAL
MIASKEGHTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLQKYADIDIRGQ
DNKTALYWAVEKGNATMVRDILQCNPDTEICTKDGETPLIKATKMRNIEVVELLLDKGAK
VSAVDKKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCSHQKSILT
QIFGARHLSPTETDGDMLGYDLYSSALADILSEPTMQPPICVGLYAQWGSGKSFLLKKLE
DEMKTFAGQQIEPLFQFSWLIVFLTLLLCGGLGLLFAFTVHPNLGIAVSLSFLALLYIFF
IVIYFGGRREGESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFT
DYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCLPSF
VIFLFIIGCIISGITLLAIFRVDPKHLTVNAVLISIASVVGLAFVLNCRTWWQVLDSLLN
SQRKRLHNAASKLHKLKSEGFMKVLKCEVELMARMAKTIDSFTQNQTRLVVIIDGLDACE
QDKVLQMLDTVRVLFSKGPFIAIFASDPHIIIKAINQNLNSVLRDSNINGHDYMRNIVHL
PVFLNSRGLSNARKFLVTSATNGDVPCSDTTGIQEDADRRVSQNSLGEMTKLGSKTALNR
RDTYRRRQMQRTITRQMSFDLTKLLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISF
NWDRLASWINLTEQWPYRTSWLILYLEETEGIPDQMTLKTIYERISKNIPTTKDVEPLLE
IDGDIRNFEVFLSSRTPVLVARDVKVFLPCTVNLDPKLREIIADVRAAREQISIGGLAYP
PLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVSPQPHSSYYSGMTGPQHPFYNRPF
FAPYLYTPRYYPGGSQHLISRPSVKTSLPRDQNNGLEVIKEDAAEGLSSPTDSSRGSGPA
PGPVVLLNSLNVDAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMN
MNFGDWHLFRSTVLEMRNAESHVVPEDPRFLSESSSGPAPHGEPARRASHNELPHTELSS
QTPYTLNFSFEELNTLGLDEGAPRHSNLSWQSQTRRTPSLSSLNSQDSSIEISKLTDKVQ
AEYRDAYREYIAQMSQLEGGPGSTTISGRSSPHSTYYMGQSSSGGSIHSNLEQEKGKDSE
PKPDDGRKSFLMKRGDVIDYSSSGVSTNDASPLDPITEEDEKSDQSGSKLLPGKKSSERS
SLFQTDLKLKGSGLRYQKLPSDEDESGTEESDNTPLLKDDKDRKAEGKVERVPKSPEHSA
EPIRTFIKAKEYLSDALLDKKDSSDSGVRSSESSPNHSLHNEVADDSQLEKANLIELEDD
SHSGKRGIPHSLSGLQDPIIARMSICSEDKKSPSECSLIASSPEENWPACQKAYNLNRTP
STVTLNNNSAPANRANQNFDEMEGIRETSQVILRPSSSPNPTTIQNENLKSMTHKRSQRS
SYTRLSKDPPELHAAASSESTGFGEERESIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q9B7	0.315	0.311	0.000	1793	0.940	0.929	E9Q9B7.pdb.gz	E9Q9B7_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
2	AFDB:Q7T163	0.244	0.256	0.000	1680	0.700	0.738	Q7T163.pdb.gz	KDISB_DANRE Kinase D-interacting substrate of 220 kDa B OS=Danio rerio OX=7955 GN=kidins220b PE=1 SV=3
3	AFDB:Q9ULH0	1.000	1.000	0.000	1771	1.000	1.000	Q9ULH0.pdb.gz	KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220 PE=1 SV=3
4	AFDB:Q54KA7	0.152	0.248	1.518E-25	986	0.084	0.151	Q54KA7.pdb.gz	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
5	PDB:8cs9A	0.199	0.410	1.101E-24	796	0.077	0.172	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
6	AFDB:Q9NCP8	0.192	0.276	1.232E-24	1159	0.081	0.123	Q9NCP8.pdb.gz	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
7	AFDB:P97582	0.209	0.413	1.825E-24	843	0.073	0.153	P97582.pdb.gz	P97582_RAT Ankyrin (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
8	AFDB:Q8NB46	0.160	0.237	1.299E-23	1076	0.074	0.122	Q8NB46.pdb.gz	ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens OX=9606 GN=ANKRD52 PE=1 SV=3
9	AFDB:G5E8K5	0.199	0.181	2.048E-21	1961	0.073	0.066	G5E8K5.pdb.gz	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
10	AFDB:Q8NFD2	0.222	0.491	2.660E-21	765	0.067	0.156	Q8NFD2.pdb.gz	ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKK1 PE=1 SV=1
11	AFDB:Q8BZ25	0.208	0.474	9.425E-21	745	0.060	0.142	Q8BZ25.pdb.gz	ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ankk1 PE=2 SV=1
12	PDB:5vkqA	0.151	0.172	1.400E-17	1499	0.115	0.135	5vkqA.pdb.gz
13	PDB:4oauC	0.154	0.377	2.866E-15	692	0.049	0.124	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.119	0.866	6.523E-11	229	0.038	0.297	2dvwA.pdb.gz
15	PDB:6aunA	0.124	0.306	3.002E-10	618	0.052	0.149	6aunA.pdb.gz
16	PDB:6v9hC	0.118	0.736	3.136E-10	270	0.037	0.244	6v9hC.pdb.gz
17	PDB:6pqpA	0.117	0.291	4.897E-9	615	0.054	0.156	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
18	PDB:1wg0A	0.115	0.758	1.395E-8	243	0.030	0.222	1wg0A.pdb.gz
19	PDB:6v9xA	0.112	0.287	4.151E-8	571	0.054	0.166	6v9xA.pdb.gz
20	PDB:6jd6B	0.084	0.704	3.225E-7	192	0.025	0.229	6jd6B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A076N1C3	0.0	1160	661	0.327	0.876	A0A076N1C3_MOUSE Truncated Kidins220 isoform m5 (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
2	A0A076N402	0.0	1254	688	0.347	0.892	A0A076N402_MOUSE Truncated Kidins220 isoform m4 (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
3	A0A076N8A1	0.0	1288	718	0.357	0.880	A0A076N8A1_MOUSE Truncated Kidins220 isoform m2 (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
4	A0A076N9K1	0.0	1283	729	0.357	0.867	A0A076N9K1_MOUSE Truncated Kidins220 isoform m1 (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
5	A0A076N9K6	0.0	1131	650	0.323	0.880	A0A076N9K6_MOUSE Truncated Kidins220 isoform m6 (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
6	A0A076NBC4	0.0	1253	699	0.348	0.881	A0A076NBC4_MOUSE Truncated Kidins220 isoform m3 (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
7	A0A1Y7VME9	0.0	3407	1763	0.932	0.936	A0A1Y7VME9_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
8	A0A1Y7VMH7	0.0	3248	1672	0.887	0.940	A0A1Y7VMH7_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
9	A0A1Y7VNF8	0.0	2271	1182	0.621	0.930	A0A1Y7VNF8_MOUSE Kinase D-interacting substrate 220 (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
10	B2RXL7	0.0	3255	1672	0.888	0.941	B2RXL7_MOUSE Kidins220 protein OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
11	E9Q9B7	0.0	3437	1793	0.941	0.929	E9Q9B7_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
12	Q3V2X2	0.0	2269	1181	0.620	0.930	Q3V2X2_MOUSE KAP NTPase domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
13	Q52KP9	0.0	1190	679	0.339	0.884	Q52KP9_MOUSE Kidins220 protein (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
14	Q7T163	0.0	2392	1680	0.706	0.745	KDISB_DANRE Kinase D-interacting substrate of 220 kDa B OS=Danio rerio OX=7955 GN=kidins220b PE=1 SV=3
15	Q80SX9	0.0	3003	1554	0.822	0.937	Q80SX9_MOUSE Kidins220 protein (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
16	Q9EQG6	0.0	3409	1762	0.934	0.939	KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus OX=10116 GN=Kidins220 PE=1 SV=2
17	Q9ULH0	0.0	3668	1771	1.000	1.000	KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220 PE=1 SV=3
18	Q8K0P2	1.84e-142	441	239	0.121	0.900	Q8K0P2_MOUSE Kidins220 protein (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
19	Q9ULJ7	1.43e-53	209	1429	0.076	0.094	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
20	A0A5F9ZHL3	1.88e-49	196	1858	0.075	0.072	A0A5F9ZHL3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.2e-54	190.9	Ankyrin repeat
2	PF12796 Ank_2	5.6e-69	240.1	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	5.9e-45	156.9	Ankyrin repeat
4	PF13637 Ank_4	3.9e-55	194.8	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.7e-54	192.5	Ankyrin repeats (many copies)
6	PF07693 KAP_NTPase	1.2e-108	374.9	KAP family P-loop domain
7	PF05729 NACHT	5	18.5	NACHT domain
8	PF03927 NapD	4.5e+02	12.3	NapD protein
9	PF00536 SAM_1	12	17.7	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256707

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000431418	0.996	High affinity nerve growth factor receptor
2	9606.ENSP00000346300	0.978	Crk-like protein
3	9606.ENSP00000277120	0.969	BDNF/NT-3 growth factors receptor
4	9606.ENSP00000414303	0.948	Brain-derived neurotrophic factor
5	9606.ENSP00000354207	0.944	NT-3 growth factor receptor
6	9606.ENSP00000358525	0.943	Beta-nerve growth factor
7	9606.ENSP00000361263	0.938	Rap guanine nucleotide exchange factor 1
8	9606.ENSP00000469455	0.919	Neurotrophin-4
9	9606.ENSP00000397297	0.914	Neurotrophin-3
10	9606.ENSP00000358723	0.908	Ras-related protein Rap-1A
11	9606.ENSP00000250559	0.903	Ras-related protein Rap-1b
12	9606.ENSP00000300574	0.883	Adapter molecule crk
13	9606.ENSP00000172229	0.838	Tumor necrosis factor receptor superfamily member 16
14	9606.ENSP00000263923	0.834	Vascular endothelial growth factor receptor 2
15	9606.ENSP00000333568	0.776	Serine/threonine-protein kinase D1
16	9606.ENSP00000220420	0.729	Protein-glutamine gamma-glutamyltransferase 5
17	9606.ENSP00000354689	0.714	Zinc transporter ZIP13
18	9606.ENSP00000264431	0.710	Rap guanine nucleotide exchange factor 2
19	9606.ENSP00000357836	0.691	Sorting nexin-27
20	9606.ENSP00000288602	0.665	Serine/threonine-protein kinase B-raf

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.304	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0043009	0.959	chordate embryonic development
GO:0048731	0.949	system development
GO:0001701	0.943	in utero embryonic development
GO:0016043	0.941	cellular component organization
GO:0032989	0.934	cellular component morphogenesis
GO:0031175	0.923	neuron projection development
GO:0032990	0.913	cell part morphogenesis
GO:0000902	0.905	cell morphogenesis
GO:0048812	0.892	neuron projection morphogenesis
GO:0048667	0.891	cell morphogenesis involved in neuron differentiation
GO:0016358	0.848	dendrite development
GO:0048813	0.844	dendrite morphogenesis
GO:0050896	0.603	response to stimulus
GO:0050789	0.565	regulation of biological process
GO:0050794	0.564	regulation of cellular process
GO:0048522	0.386	positive regulation of cellular process
GO:0051716	0.384	cellular response to stimulus
GO:0007154	0.338	cell communication
GO:0007165	0.328	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.997	membrane
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0032991	0.965	protein-containing complex
GO:0031982	0.924	vesicle
GO:0031410	0.890	cytoplasmic vesicle
GO:0005768	0.772	endosome
GO:0071944	0.729	cell periphery
GO:0005886	0.706	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]