StarFunc result for job id Q9ULH1

User Input

>input (1129 residues)
MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLL
EEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVK
FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
QKEDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHAT
SNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALT
MAFRGEQSAGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGI
HREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRK
EYITAKYVDHRFSRKTCSTSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQEL
GETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTVLHYCSMYSKPECLKLLLRSK
PTVDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEIDESDDD
LDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAFTNQIFVSTST
DSPTSPTTEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSD
PPSPLPHGPPNKGAVPWGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQK
VALRKTDHLSLDKATIPPEIFQKSSQLAELPQKPPPGDLPPKPTELAPKPQIGDLPPKPG
ELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLK
SHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQA
DNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QWY8	0.374	0.369	0.000	1147	0.961	0.946	Q9QWY8.pdb.gz	ASAP1_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Asap1 PE=1 SV=2
2	AFDB:O43150	0.309	0.340	2.271E-91	1006	0.548	0.615	O43150.pdb.gz	ASAP2_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ASAP2 PE=1 SV=3
3	AFDB:A1Z7A6	0.304	0.298	4.157E-73	1155	0.409	0.400	A1Z7A6.pdb.gz	ASAP_DROME ArfGAP with SH3 domain, ANK repeat and PH domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Asap PE=1 SV=1
4	AFDB:A0A0B4LEF8	0.276	0.274	2.567E-72	1143	0.400	0.395	A0A0B4LEF8.pdb.gz	A0A0B4LEF8_DROME ArfGAP with SH3 domain, ankyrin repeat and PH domain, isoform D OS=Drosophila melanogaster OX=7227 GN=Asap PE=4 SV=1
5	AFDB:Q54WI0	0.218	0.186	5.116E-34	1333	0.192	0.163	Q54WI0.pdb.gz	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
6	PDB:3lvqE	0.218	0.572	2.363E-21	420	0.127	0.340	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
7	PDB:3ljuX	0.106	0.312	4.408E-7	373	0.035	0.107	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
8	AFDB:Q54DW7	0.079	0.089	4.909E-6	986	0.163	0.187	Q54DW7.pdb.gz	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
9	AFDB:F4HXP0	0.106	0.180	9.990E-6	651	0.103	0.178	F4HXP0.pdb.gz	F4HXP0_ARATH ARF GAP-like zinc finger-containing protein ZIGA4 OS=Arabidopsis thaliana OX=3702 GN=ZIGA4 PE=1 SV=1
10	AFDB:P49418	0.051	0.083	2.033E-5	695	0.092	0.150	P49418.pdb.gz	AMPH_HUMAN Amphiphysin OS=Homo sapiens OX=9606 GN=AMPH PE=1 SV=1
11	AFDB:Q7TQF7	0.060	0.087	2.125E-5	686	0.097	0.159	Q7TQF7.pdb.gz	AMPH_MOUSE Amphiphysin OS=Mus musculus OX=10090 GN=Amph PE=1 SV=1
12	PDB:3o47A	0.079	0.286	2.194E-5	289	0.046	0.180	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
13	AFDB:Q9W737	0.100	0.095	5.682E-4	1194	0.093	0.088	Q9W737.pdb.gz	Q9W737_CHICK NOTCH-1 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
14	PDB:2dybA	0.051	0.188	1.558E-3	298	0.018	0.067	2dybA.pdb.gz
15	PDB:4mt6A	0.074	0.198	1.861E-3	389	0.043	0.123	4mt6A.pdb.gz
16	PDB:1bd8A	0.095	0.567	2.126E-3	156	0.021	0.154	1bd8A.pdb.gz
17	PDB:6ikoA	0.088	0.252	2.126E-3	303	0.041	0.152	6ikoA.pdb.gz
18	PDB:6bbpA	0.072	0.149	2.223E-3	520	0.019	0.042	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
19	PDB:6u3eA	0.078	0.205	2.324E-3	397	0.019	0.053	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
20	PDB:8cs9A	0.102	0.144	2.324E-3	796	0.028	0.040	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1Z7A6	0.0	689	1155	0.325	0.318	ASAP_DROME ArfGAP with SH3 domain, ANK repeat and PH domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Asap PE=1 SV=1
2	O43150	0.0	1009	1006	0.467	0.524	ASAP2_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ASAP2 PE=1 SV=3
3	O97902	0.0	2043	1129	0.949	0.949	ASAP1_BOVIN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Bos taurus OX=9913 GN=ASAP1 PE=1 SV=1
4	Q8TDY4	0.0	746	903	0.326	0.408	ASAP3_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ASAP3 PE=1 SV=1
5	Q9QWY8	0.0	2104	1147	0.950	0.935	ASAP1_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Asap1 PE=1 SV=2
6	Q9ULH1	0.0	2316	1129	1.000	1.000	ASAP1_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ASAP1 PE=1 SV=4
7	Q4QQN0	2.85e-45	176	626	0.124	0.224	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
8	A2ADA6	4.65e-45	178	829	0.125	0.170	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
9	Q6NXL5	1.13e-44	177	833	0.124	0.168	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
10	Q3UH98	2.27e-44	176	833	0.124	0.168	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
11	Q5FVC7	1.52e-43	172	770	0.117	0.171	ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Acap2 PE=1 SV=1
12	Q6ZQK5	1.56e-43	172	770	0.117	0.171	ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Acap2 PE=1 SV=2
13	Q15057	1.91e-43	172	778	0.116	0.168	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
14	Q8T0R1	3.64e-43	171	767	0.121	0.179	Q8T0R1_DROME GH12888p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
15	Q9VCQ6	5.65e-43	171	828	0.121	0.165	Q9VCQ6_DROME Centaurin beta 1A OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
16	Q15027	1.62e-37	154	740	0.118	0.180	ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1
17	Q54WI0	5.01e-35	147	1333	0.128	0.109	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
18	Q7KS50	5.21e-31	132	598	0.076	0.144	Q7KS50_DROME Centaurin beta 1A, isoform B OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
19	Q8MSZ5	1.49e-30	123	235	0.066	0.315	Q8MSZ5_DROME GM06875p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
20	Q9XX14	1.03e-29	130	1107	0.074	0.076	CNT2_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 OS=Caenorhabditis elegans OX=6239 GN=cnt-2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08792 A2L_zn_ribbon	6.5e+02	11.5	A2L zinc ribbon domain
2	PF00023 Ank	5e-05	34.7	Ankyrin repeat
3	PF12796 Ank_2	1.4e-11	56.1	Ankyrin repeats (3 copies)
4	PF13606 Ank_3	0.18	23.3	Ankyrin repeat
5	PF13637 Ank_4	0.026	26.4	Ankyrin repeats (many copies)
6	PF13857 Ank_5	67	15.2	Ankyrin repeats (many copies)
7	PF01412 ArfGap	5.7e-32	121.6	Putative GTPase activating protein for Arf
8	PF03114 BAR	9.2e-06	37.0	BAR domain
9	PF16746 BAR_3	2e-24	98.1	BAR domain of APPL family
10	PF00169 PH	2.3e-06	39.4	PH domain
11	PF14593 PH_3	2.5e+02	13.1	PH domain
12	PF15410 PH_9	5.3e+02	12.2	Pleckstrin homology domain
13	PF00018 SH3_1	4e-06	37.7	SH3 domain
14	PF07653 SH3_2	0.001	30.2	Variant SH3 domain
15	PF14604 SH3_9	3.6e-06	38.1	Variant SH3 domain
16	PF03385 STELLO	9.8	16.5	STELLO glycosyltransferases

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000429900

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306010	0.993	ADP-ribosylation factor 4
2	9606.ENSP00000440005	0.992	ADP-ribosylation factor 1
3	9606.ENSP00000341189	0.987	Focal adhesion kinase 1
4	9606.ENSP00000362680	0.983	Proto-oncogene tyrosine-protein kinase Src
5	9606.ENSP00000261890	0.967	Ras-related protein Rab-11A
6	9606.ENSP00000298316	0.967	ADP-ribosylation factor 6
7	9606.ENSP00000365745	0.963	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
8	9606.ENSP00000262305	0.961	Rab11 family-interacting protein 3
9	9606.ENSP00000296271	0.961	Rhodopsin
10	9606.ENSP00000257430	0.946	Adenomatous polyposis coli protein
11	9606.ENSP00000267257	0.945	Paxillin
12	9606.ENSP00000380921	0.941	SH3 domain-containing kinase-binding protein 1
13	9606.ENSP00000483825	0.937	NF-kappa-B essential modulator
14	9606.ENSP00000400175	0.929	Transforming protein RhoA
15	9606.ENSP00000357048	0.925	Coatomer subunit alpha
16	9606.ENSP00000447300	0.923	Rab-3A-interacting protein
17	9606.ENSP00000386918	0.921	ER lumen protein-retaining receptor 3
18	9606.ENSP00000407586	0.919	GTPase HRas
19	9606.ENSP00000348461	0.917	Ras-related C3 botulinum toxin substrate 1
20	9606.ENSP00000258739	0.915	ER lumen protein-retaining receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005096	0.998	GTPase activator activity
GO:0035091	0.976	phosphatidylinositol binding
GO:0005547	0.971	phosphatidylinositol-3,4,5-trisphosphate binding
GO:0072341	0.968	modified amino acid binding
GO:1902936	0.817	phosphatidylinositol bisphosphate binding
GO:0001786	0.816	phosphatidylserine binding
GO:0005546	0.797	phosphatidylinositol-4,5-bisphosphate binding
GO:0050839	0.743	cell adhesion molecule binding
GO:0045296	0.684	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.975	regulation of cellular process
GO:0071840	0.942	cellular component organization or biogenesis
GO:0016043	0.926	cellular component organization
GO:0051128	0.827	regulation of cellular component organization
GO:0022607	0.804	cellular component assembly
GO:0048518	0.787	positive regulation of biological process
GO:0030031	0.763	cell projection assembly
GO:0006996	0.749	organelle organization
GO:0048522	0.731	positive regulation of cellular process
GO:0044782	0.722	cilium organization
GO:0048519	0.640	negative regulation of biological process
GO:0070925	0.631	organelle assembly
GO:0065008	0.591	regulation of biological quality
GO:0120031	0.570	plasma membrane bounded cell projection assembly
GO:0051179	0.347	localization
GO:0050896	0.347	response to stimulus
GO:0051234	0.312	establishment of localization
GO:0050793	0.306	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0005886	0.949	plasma membrane
GO:0030054	0.916	cell junction
GO:0120025	0.907	plasma membrane bounded cell projection
GO:0031982	0.898	vesicle
GO:0043231	0.815	intracellular membrane-bounded organelle
GO:0005856	0.784	cytoskeleton
GO:0012505	0.783	endomembrane system
GO:0043005	0.674	neuron projection
GO:0045202	0.610	synapse
GO:0098794	0.559	postsynapse
GO:0015629	0.543	actin cytoskeleton
GO:0036477	0.452	somatodendritic compartment
GO:0098978	0.429	glutamatergic synapse
GO:0043197	0.365	dendritic spine
GO:0005634	0.360	nucleus
GO:0002102	0.355	podosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]