StarFunc result for job id Q9ULH7

User Input

>input (1088 residues)
MIDSSKKQQQGFPEILTAGDFEPLKEKECLEGSNQKSLKEVLQLRLQQRRTREQLVDQGI
MPPLKSPAAFHEQIKSLERARTENFLKHKIRSRPDRSELVRMHILEETFAEPSLQATQMK
LKRARLADDLNEKIAQRPGPMELVEKNILPVDSSVKEAIIGVGKEDYPHTQGDFSFDEDS
SDALSPDQPASQESQGSAASPSEPKVSESPSPVTTNTPAQFASVSPTVPEFLKTPPTADQ
PPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNPNDKHRSKKCKDPKPRVKKLKYHQYIPP
DQKGEKNEPQMDSNYARLLQQQQLFLQLQILSQQKQHYNYQTILPAPFKPLNDKNSNSGN
SALNNATPNTPRQNTSTPVRKPGPLPSSLDDLKVSELKTELKLRGLPVSGTKPDLIERLK
PYQEVNSSGLAAGGIVAVSSSAIVTSNPEVTVALPVTTLHNTVTSSVSTLKAELPPTGTS
NATRVENVHSPLPISPSPSEQSSLSTDDTNMADTFTEIMTMMSPSQFLSSSPLRMTNNED
SLSPTSSTLSNLELDAAEKDRKLQEKEKQIEELKRKLEQEQKLVEVLKMQLEVEKRGQQQ
RPLEAQPSAPGHSVKSDQKHGSLGSSIKDEASLPDCSSSRQPIPVASHAVGQPVSTGGQT
LVAKKAVVIKQEVPVGQAEQQSVVSQFYVSSQGQPPPAVVAQPQALLTTQTAQLLLPVSI
QGSSVTSVQLPVGSLKLQTSPQAGMQTQPQIATAAQIPTAALASGLAPTVPQTQDTFPQH
VLSQPQQVRKVFTNSASSNTVLPYQRHPAPAVQQPFINKASNSVLQSRNAPLPSLQNGPN
TPNKPSSPPPPQQFVVQHSLFGSPVAKTKDPPRYEEAIKQTRSTQAPLPEISNAHSQQMD
DLFDILIKSGEISLPIKEEPSPISKMRPVTASITTMPVNTVVSRPPPQVQMAPPVSLEPM
GSLSASLENQLEAFLDGTLPSANEIPPLQSSSEDREPFSLIEDLQNDLLSHSGMLDHSHS
PMETSETQFAAGTPCLSLDLSDSNLDNMEWLDITMPNSSSGLTPLSTTAPSMFSADFLDP
QDLPLPWD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59759	0.203	0.204	0.000	1080	0.839	0.845	P59759.pdb.gz	MRTFB_MOUSE Myocardin-related transcription factor B OS=Mus musculus OX=10090 GN=Mrtfb PE=1 SV=1
2	AFDB:Q9ULH7	1.000	1.000	0.000	1088	1.000	1.000	Q9ULH7.pdb.gz	MRTFB_HUMAN Myocardin-related transcription factor B OS=Homo sapiens OX=9606 GN=MRTFB PE=1 SV=3
3	AFDB:B0QY83	0.121	0.133	1.865E-47	981	0.425	0.471	B0QY83.pdb.gz	B0QY83_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=3
4	AFDB:A6NGG8	0.051	0.045	9.731E-5	1288	0.172	0.145	A6NGG8.pdb.gz	PCARE_HUMAN Photoreceptor cilium actin regulator OS=Homo sapiens OX=9606 GN=PCARE PE=1 SV=1
5	AFDB:M9PHB1	0.072	0.071	4.364E-4	1100	0.158	0.156	M9PHB1.pdb.gz	M9PHB1_DROME Ensconsin, isoform G OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
6	AFDB:Q3URU2	0.045	0.036	2.084E-3	1571	0.124	0.086	Q3URU2.pdb.gz	PEG3_MOUSE Paternally-expressed gene 3 protein OS=Mus musculus OX=10090 GN=Peg3 PE=1 SV=1
7	AFDB:Q8SWR8	0.051	0.051	3.436E-3	1084	0.124	0.125	Q8SWR8.pdb.gz	ATX2_DROME Ataxin-2 homolog OS=Drosophila melanogaster OX=7227 GN=Atx2 PE=1 SV=1
8	AFDB:Q9VRY4	0.046	0.038	3.436E-3	1833	0.144	0.086	Q9VRY4.pdb.gz	Q9VRY4_DROME LD13895p OS=Drosophila melanogaster OX=7227 GN=velo PE=1 SV=3
9	AFDB:O15061	0.060	0.049	5.001E-3	1565	0.164	0.114	O15061.pdb.gz	SYNEM_HUMAN Synemin OS=Homo sapiens OX=9606 GN=SYNM PE=1 SV=3
10	AFDB:Q67YI9	0.034	0.039	8.779E-3	895	0.117	0.142	Q67YI9.pdb.gz	EPN2_ARATH Clathrin interactor EPSIN 2 OS=Arabidopsis thaliana OX=3702 GN=EPSIN2 PE=1 SV=1
11	PDB:1zbuB	0.031	0.110	9.225E-1	304	0.010	0.036	1zbuB.pdb.gz	Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
12	PDB:1kcfA	0.025	0.112	2.214	240	0.011	0.050	1kcfA.pdb.gz
13	PDB:5jeaK	0.028	0.124	3.026	185	0.021	0.124	5jeaK.pdb.gz	Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
14	PDB:6hivDD	0.030	0.040	8.231	791	0.017	0.024	6hivDD.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
15	PDB:4rwtD	0.032	0.076	9.327	280	0.021	0.082	4rwtD.pdb.gz	Mechanisms of leiomodin 2-mediated regulation of actin filament in muscle cells.
16	PDB:6ff4C	0.032	0.083	9.327	286	0.022	0.084	6ff4C.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:7zs9M	0.036	0.092	9.929	310	0.006	0.019	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59759	0.0	1611	1080	0.825	0.831	MRTFB_MOUSE Myocardin-related transcription factor B OS=Mus musculus OX=10090 GN=Mrtfb PE=1 SV=1
2	Q9ULH7	0.0	2178	1088	1.000	1.000	MRTFB_HUMAN Myocardin-related transcription factor B OS=Homo sapiens OX=9606 GN=MRTFB PE=1 SV=3
3	A0A494BZX7	1.24e-148	469	898	0.290	0.352	A0A494BZX7_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=2
4	Q8K4J6	3.09e-148	470	964	0.321	0.362	MRTFA_MOUSE Myocardin-related transcription factor A OS=Mus musculus OX=10090 GN=Mrtfa PE=1 SV=2
5	F1LV40	4.04e-148	469	963	0.320	0.361	F1LV40_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=2
6	A0A8I6AI47	6.96e-148	469	992	0.320	0.351	A0A8I6AI47_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
7	A0A0G2K3Y9	1.69e-147	469	1028	0.321	0.339	A0A0G2K3Y9_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=4 SV=2
8	A0A0G2JXC5	2.39e-147	469	1038	0.320	0.335	A0A0G2JXC5_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
9	W0Z7M9	3.48e-147	467	966	0.290	0.326	W0Z7M9_HUMAN Mkl1 variant 1 Mkl1_S OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=1
10	A0A499FIJ6	7.02e-147	468	1031	0.290	0.306	A0A499FIJ6_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=2
11	B0QY83	2.85e-140	449	981	0.280	0.311	B0QY83_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=3
12	A0A8I5Y2C3	4.40e-138	443	978	0.305	0.339	A0A8I5Y2C3_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
13	A4FUJ8	3.67e-136	433	798	0.274	0.373	A4FUJ8_HUMAN MKL1 protein OS=Homo sapiens OX=9606 GN=MKL1 PE=1 SV=1
14	A0A087X287	1.12e-135	432	799	0.273	0.372	A0A087X287_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=1
15	Q969V6	7.32e-134	431	931	0.274	0.320	MRTFA_HUMAN Myocardin-related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=1
16	A0A087WU73	2.30e-127	412	882	0.263	0.324	A0A087WU73_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=1
17	A0A8I5Y4Q9	8.29e-125	408	993	0.299	0.327	A0A8I5Y4Q9_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
18	F1LVR8	1.46e-120	394	908	0.286	0.343	F1LVR8_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=2
19	A0A8I6GFP9	5.45e-120	394	938	0.294	0.341	A0A8I6GFP9_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
20	A0A8I5ZKI6	5.38e-113	374	901	0.278	0.335	A0A8I5ZKI6_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13166 AAA_13	5.2e+02	10.7	AAA domain
2	PF02755 RPEL	8.3e-18	74.7	RPEL repeat
3	PF02037 SAP	2.9e-08	44.6	SAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000013288

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000031085	0.854	Serum response factor
2	9598.ENSPTRP00000036511	0.722	Protein SCAI
3	9598.ENSPTRP00000055770	0.669	Actin-related protein 2/3 complex subunit 3
4	9598.ENSPTRP00000050582	0.601	Uncharacterized protein
5	9598.ENSPTRP00000007410	0.573	Transgelin
6	9598.ENSPTRP00000002631	0.570	Prefoldin subunit 2
7	9598.ENSPTRP00000001864	0.565	RNA binding motif protein 15
8	9598.ENSPTRP00000056157	0.548	Chromosome 17 open reading frame 106
9	9598.ENSPTRP00000058198	0.548	Apolipoprotein-L domain-containing protein 1
10	9598.ENSPTRP00000016254	0.537	Uncharacterized protein
11	9598.ENSPTRP00000039895	0.527	Uncharacterized protein
12	9598.ENSPTRP00000060167	0.524	Uncharacterized protein
13	9598.ENSPTRP00000041238	0.515	Pan troglodytes chromosome 16 open reading frame 5 (C16H16orf5), mRNA
14	9598.ENSPTRP00000012853	0.506	Small nuclear ribonucleoprotein 25kDa (U11/U12)
15	9598.ENSPTRP00000012854	0.501	Rhomboid 5 homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:0045296	0.948	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0060255	0.917	regulation of macromolecule metabolic process
GO:0080090	0.911	regulation of primary metabolic process
GO:0051171	0.911	regulation of nitrogen compound metabolic process
GO:0048518	0.908	positive regulation of biological process
GO:0009987	0.906	cellular process
GO:0048522	0.904	positive regulation of cellular process
GO:0031323	0.903	regulation of cellular metabolic process
GO:0045944	0.806	positive regulation of transcription by RNA polymerase II
GO:0032502	0.560	developmental process
GO:0048856	0.512	anatomical structure development
GO:0071840	0.375	cellular component organization or biogenesis
GO:0050793	0.357	regulation of developmental process
GO:0008152	0.350	metabolic process
GO:0032501	0.344	multicellular organismal process
GO:0051239	0.342	regulation of multicellular organismal process
GO:0050896	0.333	response to stimulus
GO:0016043	0.303	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.987	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]