StarFunc result for job id Q9ULI4

User Input

>input (1882 residues)
MVGRGVPLCAAQPAVAEGGPAREPPPLLEVSPRKRLPAGPDQDPCGSRPAPEGAGAGPEQ
GHSAGGGGWCRHCHTKLVELKRQAWKLVSGPGTTLRDPCLSALLLDKLPAPGALPACRPE
AERRCDVCATHLQQLTREAMHLLQAPASHEDLDAPHGGPSLAPPSTTTSSRDTPGPAGPA
GRQPGRAGPDRTKGLAWSPGPSVQVSVAPAGLGGALSTVTIQAQQCLEGMWSVSRVNSFL
PPACLAEAAVAAVAVADTVRECPPVAGPDGLSKAWGRGGVCTSALVTPTPGSVGGSTGPS
AAASFFIRAMQKLSLASKRKKPHPPPPPATRGTSTYPTDFSGVLQLWPPPAPPCLLRAAS
KTKDNPGSIGKVKVMLRIWPAQGAQRSAEAMSFLKVDPRKKQVILYDPAAGPPGSAGPRR
AATAAVPKMFAFDAVFPQDSEQAEVCSGTVADVLQSVVSGADGCIFSFGHMSLGKSYTMI
GKDSSPQSLGIVPCAISWLFRLIEERRERTGTRFSVRVSAVEVCGRDQSLRDLLAEVAPG
SLQDTQSPGVYLREDPVCGAQLQNQSELRAPTAEKAAFYLDAALAARSTSRAGCGEDARR
SSHMLFTLHVYQYRMEKCGRGGMSGGRSRLHLIDLGSCEAAAGRAGEAAGGPLCLSLSAL
GSVILALVNGAKHVPYRDHRLTMLLRESLATAGCRTTMIAHVSDAPAQHAETLSTVQLAA
RIHRLRRKKAKYASSSSGGESSCEEGRARRPPHLRPFHPRTVALDPDRTPPCLPGDPDYS
SSSEQSCDTVIYVGPGGAALSDRELTDNEGPPDFVPIIPALSRHRPSKGPRDADHFRCST
FAELQERLECMDGNEGPSGGPGGTDGAQASPARGGRKPSPPEAASPRKAVGTPMAASTPR
GSSGPDTHQGTPEPCKAIVWGDQREDSSAWPELLVPEKAAVSGGRRPLPSPAPPPPQLLE
ACRAPEEPGGGGTDGVARTPPVGMSGQVAGSPMLPGATCPRLAAGSRCPERGLLTTTVTL
QRPVELNGEDELVFTVVEELSLGALAGAGRPTSLASFDSDCSLRALASGSRPVSIISSIN
DEFDAYTSQAPEGGPLEGAAWAGSSHGSSISSWLSEVSVCTADSRDPTPQPRFSPDSLAG
LDPGGPPALDGSLGDGSSGFLGPDRPDSPGPTWGPCPGEVAAVAPSRPGREPQAGPSRWA
SAAQTIHSSLPRKPRTASATTRVGCARLGQSPPGRGGLFEDPWLLRVGECDTQAASAGRA
PSPTLGSPRLPEAQVMLACAQRVVDGCEVAARAARRPEAVARIPPLRRGATTLGVTTPAV
SWGDAPTEVVACSGSLKASPTSKKGLAPKAGFLPRPSGAAPPAPPTRKSSLEQRSSPASA
PPHAVNPARVGAAAVLRGEEEPRPSSRADHSVPRATSSLKARASKVEAAHRLAGHASLER
YEGLAHSSSKGREAPGRPPRAVPKLGVPPSSPTHGPAPACRSGAAKAVGAPKPPVGGGKG
RGLVAGGSRALGPSVKLSTASVTGRSPGGPVAGPRAAPRAGPSVGAKAGRGTVMGTKQAL
RAAHSRVHELSASGAPGRGGSSWGSADSDSGHDSGVNVGEERPPTGPALPSPYSKVTAPR
RPQRYSSGHGSDNSSVLSGELPPAMGRTALFHHSGGSSGYESLRRDSEATGSASSAPDSM
SESGAASPGARTRSLKSPKKRATGLQRRRLIPAPLPDTTALGRKPSLPGQWVDLPPPLAG
SLKEPFEIKVYEIDDVERLQRPRPTPREAPTQGLACVSTRLRLAERRQQRLREVQAKHKH
LCEELAETQGRLMLEPGRWLEQFEVDPELEPESAEYLAALERATAALEQCVNLCKAHVMM
VTCFDISVAASAAIPGPQEVDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q52KG5	0.348	0.348	0.000	1881	0.781	0.781	Q52KG5.pdb.gz	KI26A_MOUSE Kinesin-like protein KIF26A OS=Mus musculus OX=10090 GN=Kif26a PE=1 SV=2
2	AFDB:Q7TNC6	0.234	0.210	0.000	2112	0.456	0.406	Q7TNC6.pdb.gz	KI26B_MOUSE Kinesin-like protein KIF26B OS=Mus musculus OX=10090 GN=Kif26b PE=1 SV=3
3	AFDB:Q9ULI4	1.000	1.000	0.000	1882	1.000	1.000	Q9ULI4.pdb.gz	KI26A_HUMAN Kinesin-like protein KIF26A OS=Homo sapiens OX=9606 GN=KIF26A PE=1 SV=3
4	AFDB:Q5T7B8	0.164	0.221	2.484E-22	1368	0.131	0.181	Q5T7B8.pdb.gz	KIF24_HUMAN Kinesin-like protein KIF24 OS=Homo sapiens OX=9606 GN=KIF24 PE=1 SV=2
5	PDB:7wrgA	0.157	0.353	1.235E-20	812	0.047	0.110	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
6	AFDB:Q6S002	0.171	0.255	4.413E-19	1238	0.098	0.149	Q6S002.pdb.gz	KIF10_DICDI Kinesin-related protein 10 OS=Dictyostelium discoideum OX=44689 GN=kif10 PE=3 SV=1
7	PDB:7wrgB	0.154	0.357	5.130E-18	783	0.048	0.116	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
8	PDB:4h1gA	0.141	0.372	6.362E-18	670	0.041	0.115	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
9	AFDB:Q9NQT8	0.161	0.166	6.064E-15	1826	0.055	0.057	Q9NQT8.pdb.gz	KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2
10	AFDB:Q6S000	0.157	0.195	7.214E-14	1499	0.097	0.121	Q6S000.pdb.gz	KIF12_DICDI Kinesin-related protein 12 OS=Dictyostelium discoideum OX=44689 GN=kif12 PE=3 SV=1
11	AFDB:A0A0G2K8Z9	0.162	0.165	1.304E-13	1843	0.055	0.056	A0A0G2K8Z9.pdb.gz	A0A0G2K8Z9_RAT Kinesin family member 13B OS=Rattus norvegicus OX=10116 GN=Kif13b PE=1 SV=2
12	AFDB:Q57TT0	0.133	0.137	2.132E-8	1819	0.110	0.114	Q57TT0.pdb.gz	Q57TT0_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.750 PE=3 SV=1
13	AFDB:Q586D9	0.117	0.108	1.649E-7	2060	0.087	0.079	Q586D9.pdb.gz	Q586D9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.170 PE=4 SV=1
14	PDB:6hv93	0.026	0.059	2.526E-1	558	0.009	0.030	6hv93.pdb.gz	Structure of DNA-CMG-Pol epsilon elucidates the roles of the non-catalytic polymerase modules in the eukaryotic replisome.
15	PDB:5apnP	0.034	0.186	5.086E-1	183	0.013	0.137	5apnP.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
16	PDB:6krwA	0.028	0.102	6.657E-1	306	0.009	0.052	6krwA.pdb.gz
17	PDB:6skl3	0.024	0.051	1.204	616	0.009	0.028	6skl3.pdb.gz	Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.
18	PDB:7p2pB	0.027	0.161	1.270	179	0.006	0.061	7p2pB.pdb.gz
19	PDB:1nbhA	0.041	0.128	1.340	292	0.017	0.110	1nbhA.pdb.gz	Catalytic mechanism of glycine N-methyltransferase
20	PDB:3it8D	0.028	0.104	1.662	299	0.007	0.043	3it8D.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q52KG5	0.0	2675	1881	0.783	0.784	KI26A_MOUSE Kinesin-like protein KIF26A OS=Mus musculus OX=10090 GN=Kif26a PE=1 SV=2
2	Q7TNC6	0.0	751	2112	0.247	0.220	KI26B_MOUSE Kinesin-like protein KIF26B OS=Mus musculus OX=10090 GN=Kif26b PE=1 SV=3
3	Q9ULI4	0.0	3701	1882	1.000	1.000	KI26A_HUMAN Kinesin-like protein KIF26A OS=Homo sapiens OX=9606 GN=KIF26A PE=1 SV=3
4	O15066	9.84e-37	152	747	0.058	0.147	KIF3B_HUMAN Kinesin-like protein KIF3B OS=Homo sapiens OX=9606 GN=KIF3B PE=1 SV=1
5	D3ZI07	1.66e-36	152	747	0.058	0.147	D3ZI07_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3b PE=3 SV=1
6	Q61771	1.98e-36	151	747	0.058	0.146	KIF3B_MOUSE Kinesin-like protein KIF3B OS=Mus musculus OX=10090 GN=Kif3b PE=1 SV=1
7	P46871	4.06e-35	147	742	0.058	0.148	KRP95_STRPU Kinesin-II 95 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP95 PE=1 SV=1
8	F1QN54	9.27e-35	146	775	0.054	0.132	KIF3B_DANRE Kinesin-like protein KIF3B OS=Danio rerio OX=7955 GN=kif3b PE=2 SV=1
9	Q9Y496	3.54e-34	144	699	0.060	0.162	KIF3A_HUMAN Kinesin-like protein KIF3A OS=Homo sapiens OX=9606 GN=KIF3A PE=1 SV=4
10	E9QB71	4.81e-34	144	701	0.055	0.147	E9QB71_DANRE Kinesin-like protein OS=Danio rerio OX=7955 GN=fc55h04 PE=1 SV=1
11	Q9VRK9	8.57e-34	142	677	0.060	0.167	Q9VRK9_DROME Kinesin-like protein OS=Drosophila melanogaster OX=7227 GN=Klp64D PE=3 SV=1
12	Q9P2E2	1.08e-33	144	1029	0.060	0.109	KIF17_HUMAN Kinesin-like protein KIF17 OS=Homo sapiens OX=9606 GN=KIF17 PE=2 SV=3
13	O35066	1.53e-33	143	796	0.063	0.149	KIF3C_MOUSE Kinesin-like protein KIF3C OS=Mus musculus OX=10090 GN=Kif3c PE=1 SV=3
14	P46869	2.36e-33	142	786	0.060	0.142	FLA10_CHLRE Kinesin-like protein FLA10 OS=Chlamydomonas reinhardtii OX=3055 GN=FLA10 PE=1 SV=1
15	A0A8I6AP89	2.39e-33	141	686	0.060	0.163	A0A8I6AP89_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
16	P28741	2.66e-33	141	701	0.060	0.160	KIF3A_MOUSE Kinesin-like protein KIF3A OS=Mus musculus OX=10090 GN=Kif3a PE=1 SV=2
17	F1LQZ3	2.81e-33	141	726	0.060	0.154	F1LQZ3_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=3
18	A0A8I6AL48	3.08e-33	141	684	0.060	0.164	A0A8I6AL48_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
19	A0A0G2JUD6	4.72e-33	140	701	0.060	0.160	A0A0G2JUD6_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=2
20	P46872	4.91e-33	140	699	0.058	0.156	KRP85_STRPU Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP85 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00225 Kinesin	5.9e-50	181.7	Kinesin motor domain
2	PF16796 Microtub_bd	1.1e-08	46.7	Microtubule binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000388241

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376345	0.931	Growth factor receptor-bound protein 2
2	9606.ENSP00000354560	0.702	Kinesin-associated protein 3
3	9606.ENSP00000354791	0.690	Dynactin subunit 1
4	9606.ENSP00000378356	0.646	Kinesin-like protein KIF20A
5	9606.ENSP00000414982	0.641	Kinesin light chain 1
6	9606.ENSP00000414906	0.635	Dynactin subunit 4
7	9606.ENSP00000254286	0.622	Actin related protein 10 homolog
8	9606.ENSP00000358921	0.622	Alpha-centractin
9	9606.ENSP00000370224	0.620	Prostate androgen-regulated mucin-like protein 1
10	9606.ENSP00000281924	0.619	Transmembrane protein 163
11	9606.ENSP00000408910	0.614	Dynactin subunit 2
12	9606.ENSP00000404190	0.610	Rac GTPase-activating protein 1
13	9606.ENSP00000221114	0.608	Dynactin subunit 6
14	9606.ENSP00000300087	0.608	Dynactin subunit 5
15	9606.ENSP00000385808	0.606	Kinesin-like protein KIF3A
16	9606.ENSP00000263168	0.602	F-actin-capping protein subunit alpha-1
17	9606.ENSP00000326238	0.602	F-actin-capping protein subunit alpha-3
18	9606.ENSP00000354947	0.602	F-actin-capping protein subunit alpha-2
19	9606.ENSP00000363524	0.601	Chromosome-associated kinesin KIF4A
20	9606.ENSP00000259632	0.600	Dynactin subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008092	0.773	cytoskeletal protein binding
GO:0003774	0.661	cytoskeletal motor activity
GO:0008017	0.482	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0032501	0.859	multicellular organismal process
GO:0048856	0.850	anatomical structure development
GO:0007275	0.828	multicellular organism development
GO:0048583	0.731	regulation of response to stimulus
GO:0050896	0.686	response to stimulus
GO:0023051	0.647	regulation of signaling
GO:0010646	0.637	regulation of cell communication
GO:0051716	0.625	cellular response to stimulus
GO:0007154	0.581	cell communication
GO:0071840	0.525	cellular component organization or biogenesis
GO:0016043	0.518	cellular component organization
GO:0007017	0.474	microtubule-based process
GO:0048731	0.388	system development
GO:0006996	0.368	organelle organization
GO:0051179	0.313	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.955	organelle
GO:0043232	0.953	intracellular non-membrane-bounded organelle
GO:0043227	0.939	membrane-bounded organelle
GO:0043231	0.920	intracellular membrane-bounded organelle
GO:0005856	0.841	cytoskeleton
GO:0005634	0.752	nucleus
GO:0015630	0.544	microtubule cytoskeleton
GO:0016020	0.421	membrane
GO:0043233	0.386	organelle lumen
GO:0070013	0.364	intracellular organelle lumen
GO:0031981	0.335	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]