StarFunc result for job id Q9ULJ3

User Input

>input (1066 residues)
MEGLLHYINPAHAISLLSALNEERLKGQLCDVLLIVGDQKFRAHKNVLAASSEYFQSLFT
NKENESQTVFQLDFCEPDAFDNVLNYIYSSSLFVEKSSLAAVQELGYSLGISFLTNIVSK
TPQAPFPTCPNRKKVFVEDDENSSQKRSVIVCQSRNEAQGKTVSQNQPDVSHTSRPSPSI
AVKANTNKPHVPKPIEPLHNLSLTEKSWPKDSSVVYAKSLEHSGSLDDPNRISLVKRNAV
LPSKPLQDREAMDDKPGVSGQLPKGKALELALKRPRPPVLSVCSSSETPYLLKETNKGNG
QGEDRNLLYYSKLGLVIPSSGSGSGNQSIDRSGPLVKSLLRRSLSMDSQVPVYSPSIDLK
SSQGSSSVSSDAPGNVLCALSQKSSLKDCSEKTALDDRPQVLQPHRLRSFSASQSTDREG
ASPVTEVRIKTEPSSPLSDPSDIIRVTVGDAATTAAASSSSVTRDLSLKTEDDQKDMSRL
PAKRRFQADRRLPFKKLKVNEHGSPVSEDNFEEGSSPTLLDADFPDSDLNKDEFGELEGT
RPNKKFKCKHCLKIFRSTAGLHRHVNMYHNPEKPYACDICHKRFHTNFKVWTHCQTQHGI
VKNPSPASSSHAVLDEKFQRKLIDIVREREIKKALIIKLRRGKPGFQGQSSSQAQQVIKR
NLRSRAKGAYICTYCGKAYRFLSQFKQHIKMHPGEKPLGVNKVAKPKEHAPLASPVENKE
VYQCRLCNAKLSSLLEQGSHERLCRNAAVCPYCSLRFFSPELKQEHESKCEYKKLTCLEC
MRTFKSSFSIWRHQVEVHNQNNMAPTENFSLPVLDHNGDVTGSSRPQSQPEPNKVNHIVT
TKDDNVFSDSSEQVNFDSEDSSCLPEDLSLSKQLKIQVKEEPVEEAEEEAPEASTAPKEA
GPSKEASLWPCEKCGKMFTVHKQLERHQELLCSVKPFICHVCNKAFRTNFRLWSHFQSHM
SQASEESAHKESEVCPVPTNSPSPPPLPPPPPLPKIQPLEPDSPTGLSENPTPATEKLFV
PQESDTLFYHAPPLSAITFKRQFMCKLCHRTFKTAFSLWSHEQTHN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULJ3	0.999	0.999	0.000	1066	1.000	1.000	Q9ULJ3.pdb.gz	ZBT21_HUMAN Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2
2	AFDB:F1RAC1	0.100	0.094	1.732E-20	1146	0.144	0.134	F1RAC1.pdb.gz	F1RAC1_DANRE Zinc finger and BTB domain-containing 11 OS=Danio rerio OX=7955 GN=ZNF-U69274 PE=4 SV=1
3	AFDB:O15209	0.115	0.182	2.940E-18	634	0.117	0.197	O15209.pdb.gz	ZBT22_HUMAN Zinc finger and BTB domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZBTB22 PE=1 SV=1
4	AFDB:Q9V5M3	0.095	0.115	4.582E-18	878	0.126	0.153	Q9V5M3.pdb.gz	LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=3
5	AFDB:Q867Z4	0.095	0.104	1.848E-17	970	0.134	0.147	Q867Z4.pdb.gz	LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/T OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=1
6	AFDB:P42283	0.095	0.113	3.202E-16	891	0.143	0.171	P42283.pdb.gz	LOLA1_DROME Longitudinals lacking protein, isoform G OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=2
7	AFDB:M9NEG1	0.107	0.103	1.466E-15	1109	0.166	0.160	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
8	AFDB:Q7KQZ4	0.092	0.124	2.593E-15	787	0.120	0.163	Q7KQZ4.pdb.gz	LOLA3_DROME Longitudinals lacking protein, isoforms A/B/D/L OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=1
9	AFDB:P42282	0.114	0.142	5.912E-15	813	0.122	0.160	P42282.pdb.gz	TTKA_DROME Protein tramtrack, alpha isoform OS=Drosophila melanogaster OX=7227 GN=ttk PE=1 SV=3
10	AFDB:Q24206	0.090	0.109	7.150E-15	880	0.140	0.169	Q24206.pdb.gz	BRC4_DROME Broad-complex core protein isoform 6 OS=Drosophila melanogaster OX=7227 GN=br PE=1 SV=2
11	PDB:6wcqC	0.106	0.822	2.139E-10	130	0.031	0.254	6wcqC.pdb.gz
12	PDB:7mk2A	0.088	0.242	4.992E-5	354	0.025	0.076	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
13	PDB:2a79B	0.069	0.251	8.473E-3	259	0.013	0.054	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
14	PDB:7f3fA	0.065	0.143	8.473E-3	460	0.016	0.037	7f3fA.pdb.gz
15	PDB:3w5kB	0.041	0.275	2.826E-2	110	0.029	0.282	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
16	PDB:7sizB	0.061	0.181	3.417E-2	334	0.012	0.039	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
17	PDB:6sgaFS	0.078	0.268	3.879E-2	277	0.017	0.065	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
18	PDB:7w6sB	0.065	0.147	3.879E-2	448	0.016	0.038	7w6sB.pdb.gz
19	PDB:7phhA	0.068	0.173	4.133E-2	396	0.015	0.040	7phhA.pdb.gz
20	PDB:3lutB	0.075	0.186	4.403E-2	390	0.013	0.036	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ULJ3	0.0	2194	1066	1.000	1.000	ZBT21_HUMAN Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2
2	J3QLI2	6.02e-25	106	221	0.057	0.276	J3QLI2_HUMAN Zinc finger and BTB domain containing 14 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB14 PE=1 SV=1
3	J3QL74	1.38e-24	103	165	0.056	0.364	J3QL74_HUMAN Zinc finger and BTB domain containing 14 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB14 PE=1 SV=1
4	O43829	7.74e-24	108	449	0.056	0.134	ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZBTB14 PE=1 SV=2
5	F1LMU5	3.99e-23	106	449	0.047	0.111	F1LMU5_RAT Zinc finger protein 161 OS=Rattus norvegicus OX=10116 GN=Zfp161 PE=1 SV=2
6	Q08376	3.99e-23	106	449	0.047	0.111	ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus OX=10090 GN=Zbtb14 PE=2 SV=1
7	Q8CGQ6	4.57e-23	105	449	0.047	0.111	Q8CGQ6_RAT Zinc finger protein 161 OS=Rattus norvegicus OX=10116 GN=Zfp161 PE=2 SV=1
8	Q5EXX3	3.07e-20	99.8	1203	0.053	0.047	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
9	D6RBC4	5.38e-20	98.6	771	0.053	0.073	D6RBC4_HUMAN Zinc finger and BTB domain containing 38 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=1
10	A0A1B0GV48	5.51e-20	98.2	725	0.053	0.077	A0A1B0GV48_HUMAN Zinc finger and BTB domain containing 38 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=1
11	Q8NAP3	5.89e-20	98.6	1195	0.053	0.047	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
12	Q8VCZ7	2.83e-17	89.4	619	0.040	0.069	ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus OX=10090 GN=Zbtb7c PE=2 SV=1
13	A1YPR0	9.10e-17	87.8	619	0.039	0.068	ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens OX=9606 GN=ZBTB7C PE=2 SV=1
14	Q8UVQ4	1.31e-16	87.4	701	0.041	0.063	KAISO_XENLA Transcriptional regulator Kaiso OS=Xenopus laevis OX=8355 GN=zbtb33 PE=1 SV=2
15	Q86T24	1.48e-16	87.0	672	0.052	0.082	KAISO_HUMAN Transcriptional regulator Kaiso OS=Homo sapiens OX=9606 GN=ZBTB33 PE=1 SV=2
16	Q8BN78	2.02e-16	86.7	671	0.054	0.086	KAISO_MOUSE Transcriptional regulator Kaiso OS=Mus musculus OX=10090 GN=Zbtb33 PE=1 SV=1
17	D6RJ00	4.31e-16	78.6	146	0.035	0.253	D6RJ00_HUMAN Zinc finger and BTB domain containing 49 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB49 PE=1 SV=1
18	P35789	1.26e-15	84.0	620	0.098	0.168	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
19	O15060	3.84e-15	82.8	712	0.036	0.053	ZBT39_HUMAN Zinc finger and BTB domain-containing protein 39 OS=Homo sapiens OX=9606 GN=ZBTB39 PE=1 SV=1
20	Q6ZSB9	8.84e-15	81.6	765	0.035	0.048	ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens OX=9606 GN=ZBTB49 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	9.3e-22	88.7	BTB/POZ domain
2	PF17232 Pep1_7	9.6e+02	11.7	Elicitor peptide 1-7
3	PF11822 SANBR_BTB	4.1e+02	12.6	SANT and BTB domain regulator of CSR, BTB domain
4	PF00096 zf-C2H2	4.7e-11	53.6	Zinc finger, C2H2 type
5	PF16622 zf-C2H2_11	1.5e+02	13.6	zinc-finger C2H2-type
6	PF13894 zf-C2H2_4	1.8e-09	48.6	C2H2-type zinc finger
7	PF16278 zf-C2HE	64	15.5	C2HE / C2H2 / C2HC zinc-binding finger
8	PF13465 zf-H2C2_2	19	17.1	Zinc-finger double domain
9	PF12874 zf-met	19	17.0	Zinc-finger of C2H2 type
10	PF18450 zf_C2H2_6	4.4e-14	63.3	Zinc Finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308759

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000338217	0.714	Zinc finger protein 532
2	9606.ENSP00000343331	0.667	Lipase member I
3	9606.ENSP00000359837	0.646	ZZ-type zinc finger-containing protein 3
4	9606.ENSP00000298299	0.645	Zinc finger protein 22
5	9606.ENSP00000307746	0.639	Zinc finger protein 608
6	9606.ENSP00000339145	0.629	Ribosomal RNA processing protein 1 homolog B
7	9606.ENSP00000291565	0.621	Pyridoxal kinase
8	9606.ENSP00000369853	0.609	C2 calcium dependent domain containing 2
9	9606.ENSP00000360526	0.582	Zinc finger protein 217
10	9606.ENSP00000386126	0.554	Uromodulin like 1
11	9606.ENSP00000471277	0.547	Zinc finger protein 558
12	9606.ENSP00000332454	0.535	Receptor-interacting serine/threonine-protein kinase 4
13	9606.ENSP00000359982	0.513	Ankyrin repeat domain-containing protein 13C
14	9606.ENSP00000270112	0.510	Hormonally up-regulated Neu-associated kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003700	0.998	DNA-binding transcription factor activity
GO:0043565	0.998	sequence-specific DNA binding
GO:0001227	0.993	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000166	0.993	nucleotide binding
GO:0008327	0.943	methyl-CpG binding
GO:0031208	0.927	POZ domain binding
GO:0042802	0.922	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0019222	0.936	regulation of metabolic process
GO:0031323	0.932	regulation of cellular metabolic process
GO:0080090	0.931	regulation of primary metabolic process
GO:0060255	0.929	regulation of macromolecule metabolic process
GO:0010468	0.924	regulation of gene expression
GO:0051171	0.889	regulation of nitrogen compound metabolic process
GO:0048523	0.876	negative regulation of cellular process
GO:0051252	0.864	regulation of RNA metabolic process
GO:0009889	0.855	regulation of biosynthetic process
GO:0031326	0.846	regulation of cellular biosynthetic process
GO:0010556	0.845	regulation of macromolecule biosynthetic process
GO:0031324	0.751	negative regulation of cellular metabolic process
GO:0051172	0.750	negative regulation of nitrogen compound metabolic process
GO:0009890	0.748	negative regulation of biosynthetic process
GO:0010558	0.739	negative regulation of macromolecule biosynthetic process
GO:0045934	0.739	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.733	negative regulation of cellular biosynthetic process
GO:0006355	0.711	regulation of DNA-templated transcription
GO:0045892	0.643	negative regulation of DNA-templated transcription
GO:0006357	0.631	regulation of transcription by RNA polymerase II
GO:0009987	0.530	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.986	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]