StarFunc result for job id Q9ULJ6

User Input

>input (1067 residues)
MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFEQSLMGCLTVV
SRVAAQQGFDLDLGYRLLAVCAANRDKFTPKSAALLSSWCEELGRLLLLRHQKSRQSDPP
GKLPMQPPLSSMSSMKPTLSHSDGSFPYDSVPWQQNTNQPPGSLSVVTTVWGVTNTSQSQ
VLGNPMANANNPMNPGGNPMASGMTTSNPGLNSPQFAGQQQQFSAKAGPAQPYIQQSMYG
RPNYPGSGGFGASYPGGPNAPAGMGIPPHTRPPADFTQPAAAAAAAAVAAAAATATATAT
ATVAALQETQNKDINQYGPMGPTQAYNSQFMNQPGPRGPASMGGSMNPASMAAGMTPSGM
SGPPMGMNQPRPPGISPFGTHGQRMPQQTYPGPRPQSLPIQNIKRPYPGEPNYGNQQYGP
NSQFPTQPGQYPAPNPPRPLTSPNYPGQRMPSQPSSGQYPPPTVNMGQYYKPEQFNGQNN
TFSGSSYSNYSQGNVNRPPRPVPVANYPHSPVPGNPTPPMTPGSSIPPYLSPSQDVKPPF
PPDIKPNMSALPPPPANHNDELRLTFPVRDGVVLEPFRLEHNLAVSNHVFHLRPTVHQTL
MWRSDLELQFKCYHHEDRQMNTNWPASVQVSVNATPLTIERGDNKTSHKPLHLKHVCQPG
RNTIQITVTACCCSHLFVLQLVHRPSVRSVLQGLLKKRLLPAEHCITKIKRNFSSVAASS
GNTTLNGEDGVEQTAIKVSLKCPITFRRIQLPARGHDCKHVQCFDLESYLQLNCERGTWR
CPVCNKTALLEGLEVDQYMWGILNAIQHSEFEEVTIDPTCSWRPVPIKSDLHIKDDPDGI
PSKRFKTMSPSQMIMPNVMEMIAALGPGPSPYPLPPPPGGTNSNDYSSQGNNYQGHGNFD
FPHGNPGGTSMNDFMHGPPQLSHPPDMPNNMAALEKPLSHPMQETMPHAGSSDQPHPSIQ
QGLHVPHPSSQSGPPLHHSGAPPPPPSQPPRQPPQAAPSSHPHSDLTFNPSSALEGQAGA
QGASDMPEPSLDLLPELTNPDELLSYLDPPDLPSNSNDDLLSLFENN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P1E1	0.316	0.315	0.000	1072	0.979	0.975	Q6P1E1.pdb.gz	ZMIZ1_MOUSE Zinc finger MIZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zmiz1 PE=1 SV=1
2	AFDB:Q680Q4	0.202	0.240	1.617E-14	884	0.096	0.115	Q680Q4.pdb.gz	SIZ1_ARATH E3 SUMO-protein ligase SIZ1 OS=Arabidopsis thaliana OX=3702 GN=SIZ1 PE=1 SV=2
3	AFDB:Q70HU3	0.076	0.072	4.729E-4	1135	0.138	0.130	Q70HU3.pdb.gz	Q70HU3_DROME PNUTSDm protein OS=Drosophila melanogaster OX=7227 GN=PNUTS PE=2 SV=1
4	AFDB:Q9LE42	0.043	0.033	1.370E-3	1670	0.127	0.081	Q9LE42.pdb.gz	HAC5_ARATH Histone acetyltransferase HAC5 OS=Arabidopsis thaliana OX=3702 GN=HAC5 PE=2 SV=1
5	AFDB:M0RDF1	0.058	0.043	3.210E-3	1724	0.134	0.083	M0RDF1.pdb.gz	M0RDF1_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=1 SV=2
6	AFDB:Q7LBC6	0.053	0.039	4.658E-3	1761	0.127	0.077	Q7LBC6.pdb.gz	KDM3B_HUMAN Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2
7	AFDB:Q7YSI9	0.055	0.038	7.519E-3	1654	0.142	0.091	Q7YSI9.pdb.gz	UNC53_CAEEL Adapter protein unc-53 OS=Caenorhabditis elegans OX=6239 GN=unc-53 PE=1 SV=1
8	AFDB:A2RQR3	0.065	0.096	1.670E-2	655	0.112	0.183	A2RQR3.pdb.gz	A2RQR3_DANRE Collagen alpha-1(X) chain precursor OS=Danio rerio OX=7955 GN=wu:fa66d11 PE=4 SV=1
9	AFDB:Q54LJ4	0.090	0.042	3.912E-2	2563	0.138	0.057	Q54LJ4.pdb.gz	Q54LJ4_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286613 PE=3 SV=1
10	PDB:2waaA	0.063	0.173	3.998E-2	335	0.018	0.057	2waaA.pdb.gz
11	AFDB:Q8IMC6	0.049	0.045	4.351E-2	1262	0.111	0.094	Q8IMC6.pdb.gz	ASATR_DROME Tau-tubulin kinase homolog Asator OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=2
12	PDB:6ddtA	0.058	0.071	1.222E-1	862	0.007	0.009	6ddtA.pdb.gz	The structure of mammalian beta-mannosidase provides insight into beta-mannosidosis and nystagmus.
13	PDB:5jm0A	0.078	0.087	2.194E-1	940	0.015	0.017	5jm0A.pdb.gz
14	PDB:1olmE	0.071	0.166	2.440E-1	397	0.017	0.045	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
15	PDB:4uybA	0.055	0.126	2.440E-1	401	0.014	0.037	4uybA.pdb.gz
16	PDB:7y1rB	0.074	0.196	2.573E-1	308	0.021	0.071	7y1rB.pdb.gz
17	PDB:3i26D	0.058	0.130	3.541E-1	369	0.013	0.038	3i26D.pdb.gz	Structural basis for ligand and substrate recognition by torovirus hemagglutinin esterases
18	PDB:5e7gA	0.067	0.133	3.541E-1	446	0.016	0.038	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
19	PDB:4tlgA	0.046	0.103	4.872E-1	396	0.014	0.038	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
20	PDB:7bvfB	0.078	0.078	4.872E-1	1054	0.015	0.015	7bvfB.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EWM3	0.0	931	888	0.527	0.633	E7EWM3_HUMAN Zinc finger MIZ-type containing 2 OS=Homo sapiens OX=9606 GN=ZMIZ2 PE=1 SV=1
2	Q6P1E1	0.0	2123	1072	0.980	0.976	ZMIZ1_MOUSE Zinc finger MIZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zmiz1 PE=1 SV=1
3	Q8NF64	0.0	962	920	0.540	0.626	ZMIZ2_HUMAN Zinc finger MIZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZMIZ2 PE=1 SV=2
4	Q9ULJ6	0.0	2173	1067	1.000	1.000	ZMIZ1_HUMAN Zinc finger MIZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZMIZ1 PE=1 SV=3
5	Q7JR52	1.15e-125	413	1109	0.180	0.173	Q7JR52_DROME LD16921p OS=Drosophila melanogaster OX=7227 GN=tna PE=1 SV=1
6	Q9VTB8	1.21e-125	413	1135	0.180	0.169	Q9VTB8_DROME Tonalli, isoform A OS=Drosophila melanogaster OX=7227 GN=tna PE=1 SV=3
7	Q7KUE4	1.68e-124	410	1149	0.180	0.167	Q7KUE4_DROME Tonalli, isoform B OS=Drosophila melanogaster OX=7227 GN=tna PE=1 SV=1
8	A1Z7P5	2.54e-19	95.9	640	0.054	0.091	A1Z7P5_DROME Suppressor of variegation 2-10, isoform I OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
9	A1Z7Q1	3.54e-19	95.1	593	0.054	0.098	A1Z7Q1_DROME Suppressor of variegation 2-10, isoform B OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
10	A1Z7P8	4.12e-19	95.1	604	0.054	0.096	A1Z7P8_DROME Suppressor of variegation 2-10, isoform G OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
11	A1Z7P7	4.55e-19	94.7	569	0.054	0.102	A1Z7P7_DROME Suppressor of variegation 2-10, isoform H OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
12	Q8IGK3	4.57e-19	94.7	601	0.054	0.097	Q8IGK3_DROME RE73180p OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
13	A0A0B4LEH9	4.78e-19	94.7	577	0.054	0.101	A0A0B4LEH9_DROME Suppressor of variegation 2-10, isoform N OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
14	A1Z7P9	5.73e-19	94.4	565	0.054	0.103	A1Z7P9_DROME Suppressor of variegation 2-10, isoform C OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
15	A0A0B4K6T9	5.94e-19	94.4	570	0.054	0.102	A0A0B4K6T9_DROME Suppressor of variegation 2-10, isoform M OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
16	Q9XYM5	6.67e-19	94.0	522	0.054	0.111	Q9XYM5_DROME LD27861p OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
17	Q7KNF5	6.69e-19	94.0	554	0.054	0.105	Q7KNF5_DROME Suppressor of variegation 2-10, isoform A OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
18	A0A0B4JD33	7.08e-19	94.4	584	0.054	0.099	A0A0B4JD33_DROME Suppressor of variegation 2-10, isoform L OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
19	F4JYG0	7.73e-19	94.7	760	0.039	0.055	PIAL2_ARATH E4 SUMO-protein ligase PIAL2 OS=Arabidopsis thaliana OX=3702 GN=PIAL2 PE=1 SV=1
20	A0A0B4JCQ7	7.92e-19	94.0	537	0.054	0.108	A0A0B4JCQ7_DROME Suppressor of variegation 2-10, isoform K OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02891 zf-MIZ	2.3e-18	77.0	MIZ/SP-RING zinc finger
2	PF11789 zf-Nse	0.025	25.8	Zinc-finger of the MIZ type in Nse subunit
3	PF18028 Zmiz1_N	4.7e-45	163.3	Zmiz1 N-terminal tetratricopeptide repeat domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334474

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363822	0.967	Androgen receptor
2	9606.ENSP00000277541	0.865	Neurogenic locus notch homolog protein 1
3	9606.ENSP00000479618	0.817	Myc proto-oncogene protein
4	9606.ENSP00000395654	0.811	Transcription activator BRG1
5	9606.ENSP00000348056	0.790	SUMO-conjugating enzyme UBC9
6	9606.ENSP00000453129	0.688	N-acetylgalactosamine kinase
7	9606.ENSP00000378857	0.682	WD repeat-containing protein 6
8	9606.ENSP00000376077	0.673	Small ubiquitin-related modifier 1
9	9606.ENSP00000378306	0.666	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
10	9606.ENSP00000444156	0.666	Armadillo repeat containing 6
11	9606.ENSP00000379865	0.665	Hydroxyacid-oxoacid transhydrogenase, mitochondrial
12	9606.ENSP00000012049	0.653	Glutaminyl-peptide cyclotransferase-like protein
13	9606.ENSP00000368458	0.644	Proliferating cell nuclear antigen
14	9606.ENSP00000483936	0.624	Synaptotagmin-like protein 3
15	9606.ENSP00000287437	0.617	E3 SUMO-protein ligase NSE2
16	9606.ENSP00000344403	0.610	Plays a role in spermatogenesis.
17	9606.ENSP00000311030	0.605	Multidrug resistance-associated protein 9
18	9606.ENSP00000323678	0.605	Prostaglandin reductase 3
19	9606.ENSP00000376436	0.594	Protein C-ets-1
20	9606.ENSP00000332973	0.589	Mothers against decapentaplegic homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.502	transcription regulator activity
GO:0003824	0.497	catalytic activity
GO:0003713	0.490	transcription coactivator activity
GO:0140096	0.457	catalytic activity, acting on a protein
GO:0016740	0.447	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.987	regulation of metabolic process
GO:0048518	0.982	positive regulation of biological process
GO:0080090	0.982	regulation of primary metabolic process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0019219	0.974	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.972	regulation of gene expression
GO:0009889	0.969	regulation of biosynthetic process
GO:0010604	0.957	positive regulation of macromolecule metabolic process
GO:0048522	0.945	positive regulation of cellular process
GO:0010556	0.943	regulation of macromolecule biosynthetic process
GO:0051252	0.941	regulation of RNA metabolic process
GO:0031326	0.940	regulation of cellular biosynthetic process
GO:0051173	0.932	positive regulation of nitrogen compound metabolic process
GO:0009987	0.931	cellular process
GO:2001141	0.928	regulation of RNA biosynthetic process
GO:0045935	0.918	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.912	regulation of DNA-templated transcription
GO:0010557	0.907	positive regulation of macromolecule biosynthetic process
GO:0031328	0.903	positive regulation of cellular biosynthetic process
GO:0051254	0.897	positive regulation of RNA metabolic process
GO:0045944	0.892	positive regulation of transcription by RNA polymerase II
GO:0050896	0.666	response to stimulus
GO:0051716	0.573	cellular response to stimulus
GO:0008152	0.516	metabolic process
GO:0032502	0.503	developmental process
GO:0032501	0.436	multicellular organismal process
GO:0048856	0.402	anatomical structure development
GO:0044237	0.308	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0005829	0.993	cytosol
GO:0032991	0.709	protein-containing complex
GO:0043232	0.398	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.447	Transferases.

[back to server]