StarFunc result for job id Q9ULJ7

User Input

>input (1429 residues)
MTNPWEEKVCKMAQTSLLQGKQFYCREWVFHKLQHCLQEKSNCCNSAVNAPSLVMNSGNN
ASGVSGKGAAWGVLLVGGPGSGKTALCTELLWPSSPASLQRGLHRQALAFHFCKAQDSDT
LCVGGFIRGLVAQICRSGLLQGYEDKLRDPAVQSLLQPGECERNPAEAFKRCVLLPLLGM
KPPQQSLYLLVDSVDEGCNITEGEQTSTSLSGTVAALLAGHHEFFPPWLLLLCSARKQSK
AVTKMFTGFRKISLDDLRKAYIVKDVQQYILHRLDQEEALRQHLTKETAEMLNQLHIKSS
GCFLYLERVLDGVVENFIMLREIRDIPGTLNGLYLWLCQRLFVRKQFAKVQPILNVILAA
CRPLTITELYHAVWTKNMSLTLEDFQRKLDILSKLLVDGLGNTKILFHYSFAEWLLDVKH
CTQKYLCNAAEGHRMLAMSYTCQAKNLTPLEAQEFALHLINSNLQLETAELALWMIWNGT
PVRDSLSTLIPKEQEVLQLLVKAGAHVNSEDDRTSCIVRQALEREDSIRTLLDNGASVNQ
CDSNGRTLLANAAYSGSLDVVNLLVSRGADLEIEDAHGHTPLTLAARQGHTKVVNCLIGC
GANINHTDQDGWTALRSAAWGGHTEVVSALLYAGVKVDCADADSRTALRAAAWGGHEDIV
LNLLQHGAEVNKADNEGRTALIAAAYMGHREIVEHLLDHGAEVNHEDVDGRTALSVAALC
VPASKGHASVVSLLIDRGAEVDHCDKDGMTPLLVAAYEGHVDVVDLLLEGGADVDHTDNN
GRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDE
NHRDDAGWTPLHMAAFEGHRLICEALIEQGARTNEIDNDGRIPFILASQEGHYDCVQILL
ENKSNIDQRGYDGRNALRVAALEGHRDIVELLFSHGADVNCKDADGRPTLYILALENQLT
MAEYFLENGANVEASDAEGRTALHVSCWQGHMEMVQVLIAYHADVNAADNEKRSALQSAA
WQGHVKVVQLLIEHGAVVDHTCNQGATALCIAAQEGHIDVVQVLLEHGADPNHADQFGRT
AMRVAAKNGHSQIIKLLEKYGASSLNGCSPSPVHTMEQKPLQSLSSKVQSLTIKSNSSGS
TGGGDMQPSLRGLPNGPTHAFSSPSESPDSTVDRQKSSLSNNSLKSSKNSSLRTTSSTAT
AQTVPIDSFHNLSFTEQIQQHSLPRSRSRQSIVSPSSTTQSLGQSHNSPSSEFEWSQVKP
SLKSTKASKGGKSENSAKSGSAGKKAKQSNSSQPKVLEYEMTQFDRRGPIAKSGTAAPPK
QMPAESQCKIMIPSAQQEIGRSQQQFLIHQQSGEQKKRNGIMTNPNYHLQSNQVFLGRVS
VPRTMQDRGHQEVLEGYPSSETELSLKQALKLQIEGSDPSFNYKKETPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULJ7	1.000	1.000	0.000	1429	1.000	1.000	Q9ULJ7.pdb.gz	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
2	AFDB:A2A690	0.304	0.222	6.394E-44	1994	0.230	0.164	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
3	AFDB:Q0VGY8	0.301	0.236	1.743E-42	1856	0.231	0.178	Q0VGY8.pdb.gz	TANC1_MOUSE Protein TANC1 OS=Mus musculus OX=10090 GN=Tanc1 PE=1 SV=2
4	AFDB:Q9C0D5	0.303	0.236	3.179E-42	1861	0.231	0.177	Q9C0D5.pdb.gz	TANC1_HUMAN Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3
5	AFDB:Q9NCP8	0.366	0.442	6.538E-36	1159	0.166	0.204	Q9NCP8.pdb.gz	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
6	PDB:8cs9A	0.363	0.621	6.751E-33	796	0.152	0.273	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
7	AFDB:O75179	0.243	0.146	6.273E-29	2603	0.218	0.119	O75179.pdb.gz	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
8	AFDB:A0A0G2K916	0.248	0.149	1.175E-27	2615	0.168	0.092	A0A0G2K916.pdb.gz	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
9	AFDB:E9QEX9	0.245	0.149	1.471E-27	2607	0.160	0.087	E9QEX9.pdb.gz	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
10	PDB:5vkqA	0.315	0.302	8.780E-23	1499	0.150	0.143	5vkqA.pdb.gz
11	AFDB:A0A0R4IA11	0.175	0.414	2.653E-16	563	0.092	0.233	A0A0R4IA11.pdb.gz
12	AFDB:Q8WXD9	0.168	0.168	1.556E-12	1431	0.115	0.115	Q8WXD9.pdb.gz	CSKI1_HUMAN Caskin-1 OS=Homo sapiens OX=9606 GN=CASKIN1 PE=1 SV=1
13	PDB:4oauC	0.173	0.330	1.644E-11	692	0.071	0.147	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.151	0.893	8.486E-10	229	0.050	0.310	2dvwA.pdb.gz
15	PDB:6v9hC	0.147	0.749	1.254E-7	270	0.049	0.259	6v9hC.pdb.gz
16	PDB:6aunA	0.171	0.371	1.404E-7	618	0.054	0.125	6aunA.pdb.gz
17	PDB:6mwqA	0.104	0.297	3.089E-7	493	0.042	0.122	6mwqA.pdb.gz
18	PDB:1wg0A	0.079	0.417	9.181E-7	243	0.045	0.267	1wg0A.pdb.gz
19	PDB:6pqpA	0.131	0.283	1.496E-6	615	0.062	0.145	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
20	PDB:6jd6B	0.104	0.750	3.054E-6	192	0.025	0.188	6jd6B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ULJ7	0.0	2960	1429	1.000	1.000	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
2	A0A0S2Z6F4	3.92e-98	313	160	0.108	0.969	A0A0S2Z6F4_HUMAN Ankyrin repeat domain 50 isoform 2 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=1
3	F1LTE0	1.93e-93	337	1992	0.192	0.138	TANC2_RAT Protein TANC2 OS=Rattus norvegicus OX=10116 GN=Tanc2 PE=1 SV=2
4	A2A690	2.27e-93	336	1994	0.190	0.136	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
5	Q9HCD6	9.83e-93	334	1990	0.189	0.136	TANC2_HUMAN Protein TANC2 OS=Homo sapiens OX=9606 GN=TANC2 PE=1 SV=3
6	Q6F6B3	9.95e-88	318	1849	0.176	0.136	TANC1_RAT Protein TANC1 OS=Rattus norvegicus OX=10116 GN=Tanc1 PE=1 SV=1
7	Q0VGY8	2.01e-86	314	1856	0.174	0.134	TANC1_MOUSE Protein TANC1 OS=Mus musculus OX=10090 GN=Tanc1 PE=1 SV=2
8	P16157	1.14e-84	309	1881	0.143	0.109	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
9	Q9C0D5	1.72e-84	308	1861	0.174	0.134	TANC1_HUMAN Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3
10	Q02357	5.87e-84	306	1862	0.143	0.110	ANK1_MOUSE Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV=2
11	A0A8I6A0H1	9.10e-84	306	1887	0.143	0.109	A0A8I6A0H1_RAT Ankyrin 1 OS=Rattus norvegicus OX=10116 GN=Ank1 PE=1 SV=1
12	A0A8I6ABK4	1.01e-83	306	1852	0.143	0.111	A0A8I6ABK4_RAT Ankyrin 1 OS=Rattus norvegicus OX=10116 GN=Ank1 PE=1 SV=1
13	A0A8I5ZS64	1.08e-83	306	1878	0.143	0.109	A0A8I5ZS64_RAT Ankyrin 1 OS=Rattus norvegicus OX=10116 GN=Ank1 PE=1 SV=1
14	A0A8I6GAS7	1.25e-83	305	1870	0.143	0.110	A0A8I6GAS7_RAT Ankyrin 1 OS=Rattus norvegicus OX=10116 GN=Ank1 PE=1 SV=1
15	A0A8I5ZJ94	1.26e-83	305	1907	0.143	0.107	A0A8I5ZJ94_RAT Ankyrin 1 OS=Rattus norvegicus OX=10116 GN=Ank1 PE=1 SV=1
16	Q8SWY2	3.11e-82	295	1009	0.154	0.218	Q8SWY2_DROME GH01626p OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=2 SV=1
17	F1M5N3	4.99e-82	301	3966	0.136	0.049	F1M5N3_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4
18	A0A0G2KBB9	1.25e-81	300	4017	0.137	0.049	A0A0G2KBB9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
19	A0A5F9ZGY1	1.28e-81	299	1887	0.136	0.103	A0A5F9ZGY1_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A0G2JZ56	1.34e-81	300	4013	0.137	0.049	A0A0G2JZ56_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	1.9	20.3	AAA ATPase domain
2	PF00023 Ank	4.1e-76	259.7	Ankyrin repeat
3	PF12796 Ank_2	2e-101	344.0	Ankyrin repeats (3 copies)
4	PF13606 Ank_3	1.8e-62	210.6	Ankyrin repeat
5	PF13637 Ank_4	5.8e-96	325.0	Ankyrin repeats (many copies)
6	PF13857 Ank_5	3.9e-70	242.3	Ankyrin repeats (many copies)
7	PF05729 NACHT	4.5e+02	12.1	NACHT domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000425658

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274008	0.729	Spermatogenesis-associated protein 5
2	9606.ENSP00000339449	0.721	Cilia- and flagella-associated protein 52
3	9606.ENSP00000225174	0.704	Peptidyl-prolyl cis-trans isomerase F, mitochondrial
4	9606.ENSP00000233712	0.698	Protein eva-1 homolog A
5	9606.ENSP00000296513	0.691	Adenosine deaminase domain-containing protein 1
6	9606.ENSP00000357836	0.669	Sorting nexin-27
7	9606.ENSP00000385347	0.669	Transmembrane anterior posterior transformation protein 1 homolog
8	9606.ENSP00000217964	0.653	F-box-like/WD repeat-containing protein TBL1X
9	9606.ENSP00000405574	0.653	F-box-like/WD repeat-containing protein TBL1XR1
10	9606.ENSP00000353210	0.633	ADP-ribosylation factor-like protein 9
11	9606.ENSP00000349929	0.621	Serologically defined colon cancer antigen 3
12	9606.ENSP00000298355	0.618	E3 ubiquitin-protein ligase TRIM9
13	9606.ENSP00000422473	0.617	Transmembrane protein 33
14	9606.ENSP00000316891	0.616	LIM and calponin homology domains 1
15	9606.ENSP00000345064	0.578	Prickle-like protein 1
16	9606.ENSP00000480853	0.574	Vacuolar protein sorting-associated protein 29
17	9606.ENSP00000299138	0.568	Vacuolar protein sorting-associated protein 35
18	9606.ENSP00000393275	0.562	Nanos homolog 1
19	9606.ENSP00000312379	0.560	Histone-lysine N-methyltransferase 2E
20	9606.ENSP00000342181	0.554	Signal recognition particle subunit SRP72

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0016197	0.843	endosomal transport
GO:0051668	0.816	localization within membrane
GO:0065007	0.804	biological regulation
GO:0050789	0.784	regulation of biological process
GO:0050794	0.766	regulation of cellular process
GO:0032456	0.705	endocytic recycling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0070013	0.993	intracellular organelle lumen
GO:0005829	0.985	cytosol
GO:0005634	0.971	nucleus
GO:0031981	0.943	nuclear lumen
GO:0016020	0.857	membrane
GO:0043228	0.771	non-membrane-bounded organelle
GO:0005654	0.736	nucleoplasm
GO:0043232	0.706	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]