StarFunc result for job id Q9ULK0

User Input

>input (1009 residues)
MEALTLWLLPWICQCVSVRADSIIHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKI
TYSIKVIEANNPFQAVQEACDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNP
GGSPRTACHLNPSPDGEAYTLASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQS
FLDQASRLGLDVSLQKVDKNISHVFTSLFTTMKTEELNRYRDTLRRAILLLSPQGAHSFI
NEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCTRNNHR
ISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWN
GGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKG
LNGSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGF
KYEIYQAPDGRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYS
VGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPS
ASATLHSAIWIVYGAFVQQGGESSVNSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSR
MDNPIRTFQDLSKQVEMSYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADN
CVSSPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPY
RDLFSQRILELQDTGDLDVLKQKWWPHMGRCDLTSHASAQADGKSLKLHSFAGVFCILAI
GLLLACLVAALELWWNSNRCHQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIEL
SALEMGGLAPTQTLEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSAT
MPSMQCKHRSPNGGLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43424	0.785	0.786	0.000	1007	0.557	0.558	O43424.pdb.gz	GRID2_HUMAN Glutamate receptor ionotropic, delta-2 OS=Homo sapiens OX=9606 GN=GRID2 PE=1 SV=2
2	AFDB:Q61627	0.909	0.909	0.000	1009	0.984	0.984	Q61627.pdb.gz	GRID1_MOUSE Glutamate receptor ionotropic, delta-1 OS=Mus musculus OX=10090 GN=Grid1 PE=1 SV=2
3	PDB:7rz4A	0.453	0.460	2.666E-63	993	0.241	0.245	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
4	PDB:7rzaA	0.414	0.424	5.692E-62	981	0.244	0.251	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
5	PDB:7ocaA	0.419	0.521	3.651E-61	775	0.226	0.294	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
6	PDB:5kbtA	0.434	0.448	6.892E-58	973	0.238	0.247	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
7	PDB:4u1xC	0.458	0.584	2.423E-57	755	0.228	0.305	4u1xC.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.
8	PDB:5idfB	0.374	0.474	1.641E-56	734	0.220	0.302	5idfB.pdb.gz
9	PDB:4u1wA	0.482	0.624	2.278E-56	731	0.222	0.306	4u1wA.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.
10	PDB:5weoA	0.447	0.455	4.898E-56	988	0.242	0.247	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
11	AFDB:B7ZSK1	0.309	0.224	2.260E-53	1451	0.206	0.143	B7ZSK1.pdb.gz	NMDE1_XENLA Glutamate receptor ionotropic, NMDA 2A OS=Xenopus laevis OX=8355 GN=grin2a PE=1 SV=1
12	PDB:7vm2B	0.339	0.448	3.856E-53	736	0.236	0.323	7vm2B.pdb.gz
13	PDB:4uqqA	0.408	0.555	1.882E-52	693	0.220	0.320	4uqqA.pdb.gz	Structural Mechanism of Glutamate Receptor Activation and Desensitization
14	AFDB:O60391	0.371	0.360	7.471E-52	1043	0.192	0.186	O60391.pdb.gz	NMD3B_HUMAN Glutamate receptor ionotropic, NMDA 3B OS=Homo sapiens OX=9606 GN=GRIN3B PE=2 SV=2
15	AFDB:Q91ZU9	0.388	0.390	4.537E-51	1003	0.192	0.193	Q91ZU9.pdb.gz	NMD3B_MOUSE Glutamate receptor ionotropic, NMDA 3B OS=Mus musculus OX=10090 GN=Grin3b PE=1 SV=1
16	AFDB:Q9V9T2	0.380	0.579	9.426E-22	603	0.090	0.151	Q9V9T2.pdb.gz	Q9V9T2_DROME Ionotropic receptor 100a OS=Drosophila melanogaster OX=7227 GN=Ir100a PE=4 SV=2
17	AFDB:Q9H252	0.095	0.096	4.507E-2	994	0.080	0.081	Q9H252.pdb.gz	KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1
18	AFDB:Q9UL51	0.082	0.092	5.028E-2	889	0.072	0.082	Q9UL51.pdb.gz	HCN2_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Homo sapiens OX=9606 GN=HCN2 PE=1 SV=3
19	AFDB:D3ZAX5	0.042	0.045	3.406E-1	935	0.056	0.060	D3ZAX5.pdb.gz	D3ZAX5_RAT Calcium homeostasis endoplasmic reticulum protein OS=Rattus norvegicus OX=10116 GN=Cherp PE=1 SV=3
20	AFDB:Q9WUS4	0.055	0.096	3.799E-1	505	0.066	0.133	Q9WUS4.pdb.gz	CXA10_MOUSE Gap junction alpha-10 protein OS=Mus musculus OX=10090 GN=Gja10 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43424	0.0	1197	1007	0.562	0.563	GRID2_HUMAN Glutamate receptor ionotropic, delta-2 OS=Homo sapiens OX=9606 GN=GRID2 PE=1 SV=2
2	Q61625	0.0	1192	1007	0.560	0.561	GRID2_MOUSE Glutamate receptor ionotropic, delta-2 OS=Mus musculus OX=10090 GN=Grid2 PE=1 SV=1
3	Q61627	0.0	2075	1009	0.984	0.984	GRID1_MOUSE Glutamate receptor ionotropic, delta-1 OS=Mus musculus OX=10090 GN=Grid1 PE=1 SV=2
4	Q62640	0.0	2076	1009	0.984	0.984	GRID1_RAT Glutamate receptor ionotropic, delta-1 OS=Rattus norvegicus OX=10116 GN=Grid1 PE=1 SV=1
5	Q63226	0.0	1190	1007	0.554	0.555	GRID2_RAT Glutamate receptor ionotropic, delta-2 OS=Rattus norvegicus OX=10116 GN=Grid2 PE=1 SV=2
6	Q9ULK0	0.0	2102	1009	1.000	1.000	GRID1_HUMAN Glutamate receptor ionotropic, delta-1 OS=Homo sapiens OX=9606 GN=GRID1 PE=2 SV=2
7	H7BYG7	1.25e-117	384	871	0.269	0.311	H7BYG7_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
8	E9PD61	3.35e-117	384	920	0.271	0.297	E9PD61_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
9	P39086	3.70e-117	384	918	0.271	0.297	GRIK1_HUMAN Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
10	E7ENK3	6.56e-117	384	949	0.271	0.288	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
11	F7AGW3	1.23e-116	383	949	0.271	0.288	F7AGW3_MACMU Glutamate receptor OS=Macaca mulatta OX=9544 GN=GRIK1 PE=3 SV=2
12	P22756	6.01e-115	379	949	0.270	0.287	GRIK1_RAT Glutamate receptor ionotropic, kainate 1 OS=Rattus norvegicus OX=10116 GN=Grik1 PE=1 SV=3
13	Q13002	2.27e-113	373	908	0.268	0.297	GRIK2_HUMAN Glutamate receptor ionotropic, kainate 2 OS=Homo sapiens OX=9606 GN=GRIK2 PE=1 SV=1
14	P42264	3.01e-113	373	919	0.261	0.286	GRIK3_RAT Glutamate receptor ionotropic, kainate 3 OS=Rattus norvegicus OX=10116 GN=Grik3 PE=1 SV=1
15	P39087	3.09e-113	373	908	0.267	0.296	GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4
16	P42260	3.64e-113	373	908	0.267	0.296	GRIK2_RAT Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus OX=10116 GN=Grik2 PE=1 SV=2
17	Q38PU3	9.90e-113	372	908	0.265	0.294	GRIK2_MACFA Glutamate receptor ionotropic, kainate 2 OS=Macaca fascicularis OX=9541 GN=GRIK2 PE=2 SV=1
18	Q38PU2	1.06e-112	372	919	0.263	0.288	GRIK3_MACFA Glutamate receptor ionotropic, kainate 3 OS=Macaca fascicularis OX=9541 GN=GRIK3 PE=2 SV=1
19	Q13003	1.09e-112	372	919	0.262	0.287	GRIK3_HUMAN Glutamate receptor ionotropic, kainate 3 OS=Homo sapiens OX=9606 GN=GRIK3 PE=2 SV=3
20	B1AS29	2.07e-112	371	919	0.261	0.286	GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus OX=10090 GN=Grik3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	2.4e-54	196.4	Receptor family ligand binding region
2	PF00060 Lig_chan	9.3e-40	147.3	Ligand-gated ion channel
3	PF10613 Lig_chan-Glu_bd	1.1e-35	133.6	Ligated ion channel L-glutamate- and glycine-binding site
4	PF13458 Peripla_BP_6	8.8	17.6	Periplasmic binding protein
5	PF00497 SBP_bac_3	3.8e-22	90.4	Bacterial extracellular solute-binding proteins, family 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330148

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381412	0.795	Calcium/calmodulin-dependent protein kinase type II subunit alpha
2	9606.ENSP00000306138	0.749	Metabotropic glutamate receptor 5
3	9606.ENSP00000265459	0.727	Neurexin-2
4	9606.ENSP00000378492	0.724	Metabotropic glutamate receptor 2
5	9606.ENSP00000269503	0.715	Cerebellin-2
6	9606.ENSP00000384966	0.702	Mitochondrial inner membrane protease subunit 2
7	9606.ENSP00000219197	0.683	Cerebellin-1
8	9606.ENSP00000282030	0.678	SET binding protein 1
9	9606.ENSP00000354896	0.668	Metabotropic glutamate receptor 1
10	9606.ENSP00000477455	0.665	Glutamate receptor ionotropic, NMDA 2B
11	9606.ENSP00000339017	0.654	ATPase family AAA domain-containing protein 1
12	9606.ENSP00000436262	0.627	Kelch repeat and BTB domain containing 3
13	9606.ENSP00000408695	0.624	Protein kinase C alpha type
14	9606.ENSP00000287907	0.614	5-hydroxytryptamine receptor 5A
15	9606.ENSP00000440556	0.612	Metabotropic glutamate receptor 4
16	9606.ENSP00000231188	0.598	Metabotropic glutamate receptor 6
17	9606.ENSP00000380779	0.594	Tectonic-1
18	9606.ENSP00000483364	0.593	Tectonic-3
19	9606.ENSP00000316377	0.591	Disks large-associated protein 1
20	9606.ENSP00000425040	0.589	Coiled-coil serine rich protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004888	0.998	transmembrane signaling receptor activity
GO:0042802	0.994	identical protein binding
GO:0008066	0.990	glutamate receptor activity
GO:0015276	0.976	ligand-gated monoatomic ion channel activity
GO:0005230	0.924	extracellular ligand-gated monoatomic ion channel activity
GO:0030594	0.912	neurotransmitter receptor activity
GO:0022890	0.882	inorganic cation transmembrane transporter activity
GO:0004970	0.875	ionotropic glutamate receptor activity
GO:0008324	0.342	monoatomic cation transmembrane transporter activity
GO:0005261	0.315	monoatomic cation channel activity
GO:0043167	0.308	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.990	regulation of cellular process
GO:0032501	0.964	multicellular organismal process
GO:0050803	0.943	regulation of synapse structure or activity
GO:0009987	0.929	cellular process
GO:0050807	0.862	regulation of synapse organization
GO:0007154	0.640	cell communication
GO:0023052	0.621	signaling
GO:0050896	0.551	response to stimulus
GO:0051716	0.416	cellular response to stimulus
GO:0007165	0.302	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005886	0.999	plasma membrane
GO:0045202	0.997	synapse
GO:0098794	0.982	postsynapse
GO:0043227	0.977	membrane-bounded organelle
GO:0098590	0.975	plasma membrane region
GO:0097060	0.962	synaptic membrane
GO:0045211	0.928	postsynaptic membrane
GO:0099572	0.866	postsynaptic specialization
GO:0005622	0.808	intracellular anatomical structure
GO:0099634	0.794	postsynaptic specialization membrane
GO:0043231	0.780	intracellular membrane-bounded organelle
GO:0032991	0.685	protein-containing complex
GO:0005737	0.661	cytoplasm
GO:0098978	0.603	glutamatergic synapse
GO:0098984	0.578	neuron to neuron synapse
GO:0032279	0.500	asymmetric synapse
GO:0014069	0.469	postsynaptic density
GO:0005576	0.432	extracellular region
GO:0098839	0.382	postsynaptic density membrane
GO:0031982	0.377	vesicle
GO:0005615	0.309	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]