StarFunc result for job id Q9ULK2

User Input

>input (861 residues)
MTSERSRIPCLSAAAAEGTGKKQQEGRAMATLDRKVPSPEAFLGKPWSSWIDAAKLHCSD
NVDLEEAGKEGGKSREVMRLNKEDMHLFGHYPAHDDFYLVVCSACNQVVKPQVFQSHCER
RHGSMCRPSPSPVSPASNPRTSLVQVKTKACLSGHHSASSTSKPFKTPKDNLLTSSSKQH
TVFPAKGSRDKPCVPVPVVSLEKIPNLVKADGANVKMNSTTTTAVSASSTSSSAVSTPPL
IKPVLMSKSVPPSPEKILNGKGILPTTIDKKHQNGTKNSNKPYRRLSEREFDPNKHCGVL
DPETKKPCTRSLTCKTHSLSHRRAVPGRKKQFDLLLAEHKAKSREKEVKDKEHLLTSTRE
ILPSQSGPAQDSLLGSSGSSGPEPKVASPAKSRPPNSVLPRPSSANSISSSTSSNHSGHT
PEPPLPPVGGDLASRLSSDEGEMDGADESEKLDCQFSTHHPRPLAFCSFGSRLMGRGYYV
FDRRWDRFRFALNSMVEKHLNSQMWKKIPPAADSPLPSPAAHITTPVPASVLQPFSNPSA
VYLPSAPISSRLTSSYIMTSAMLSNAAFVTSPDPSALMSHTTAFPHVAATLSIMDSTFKA
PSAVSPIPAVIPSPSHKPSKTKTSKSSKVKDLSTRSDESPSNKKRKPQSSTSSSSSSSSS
SLQTSLSSPLSGPHKKNCVLNASSALNSYQAAPPYNSLSVHNSNNGVSPLSAKLEPSGRT
SLPGGPADIVRQVGAVGGSSDSCPLSVPSLALHAGDLSLASHNAVSSLPLSFDKSEGKKR
KNSSSSSKACKITKMPGMNSVHKKNPPSLLAPVPDPVNSTSSRQVGKNSSLALSQSSPSS
ISSPGHSRQNTNRTGRIRTLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULK2	0.999	0.999	0.000	861	1.000	1.000	Q9ULK2.pdb.gz	AT7L1_HUMAN Ataxin-7-like protein 1 OS=Homo sapiens OX=9606 GN=ATXN7L1 PE=1 SV=3
2	AFDB:A4D0Q3	0.137	0.152	1.285E-71	759	0.715	0.812	A4D0Q3.pdb.gz	A4D0Q3_HUMAN KIAA1218 protein OS=Homo sapiens OX=9606 GN=KIAA1218 PE=1 SV=1
3	AFDB:A0A2R8YDD6	0.154	0.150	3.763E-42	892	0.389	0.376	A0A2R8YDD6.pdb.gz	A0A2R8YDD6_HUMAN Ataxin 7 OS=Homo sapiens OX=9606 GN=ATXN7 PE=1 SV=1
4	AFDB:Q8R4I1	0.146	0.145	1.884E-41	867	0.372	0.369	Q8R4I1.pdb.gz	ATX7_MOUSE Ataxin-7 OS=Mus musculus OX=10090 GN=Atxn7 PE=1 SV=2
5	AFDB:E7F640	0.166	0.165	8.581E-39	866	0.351	0.349	E7F640.pdb.gz	E7F640_DANRE Ataxin 7 OS=Danio rerio OX=7955 GN=atxn7 PE=4 SV=1
6	PDB:7ktrN	0.054	0.535	6.537E-5	53	0.043	0.698	7ktrN.pdb.gz	Structure of the human SAGA coactivator complex.
7	AFDB:Q8WWM7	0.046	0.042	1.559E-3	1075	0.157	0.126	Q8WWM7.pdb.gz	ATX2L_HUMAN Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2
8	AFDB:O75362	0.058	0.050	1.773E-3	1048	0.151	0.124	O75362.pdb.gz	ZN217_HUMAN Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1
9	AFDB:A8JNK1	0.048	0.035	2.610E-3	1241	0.156	0.108	A8JNK1.pdb.gz	A8JNK1_DROME Ensconsin, isoform F OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
10	AFDB:Q9P2G4	0.056	0.054	4.370E-3	905	0.148	0.140	Q9P2G4.pdb.gz	MAP10_HUMAN Microtubule-associated protein 10 OS=Homo sapiens OX=9606 GN=MAP10 PE=1 SV=2
11	AFDB:Q9VP80	0.051	0.039	1.010E-2	1325	0.130	0.085	Q9VP80.pdb.gz	Q9VP80_DROME FI21420p1 OS=Drosophila melanogaster OX=7227 GN=siz PE=1 SV=2
12	PDB:7pntO	0.027	0.065	9.056E-1	197	0.016	0.071	7pntO.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
13	PDB:6t9lN	0.033	0.280	1.099	82	0.016	0.171	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.
14	PDB:3w5kB	0.036	0.195	2.093	110	0.012	0.091	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
15	PDB:3mhhC	0.032	0.282	3.737	93	0.008	0.075	3mhhC.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
16	PDB:5gm6a	0.043	0.197	4.251	123	0.019	0.130	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:5c0xK	0.029	0.056	5.501	350	0.009	0.023	5c0xK.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
18	PDB:5c0wK	0.037	0.052	7.119	576	0.010	0.016	5c0wK.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
19	PDB:6ydhA	0.022	0.227	7.119	62	0.003	0.048	6ydhA.pdb.gz
20	PDB:6gejS	0.038	0.131	7.592	208	0.021	0.087	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4D0Q3	0.0	602	759	0.341	0.387	A4D0Q3_HUMAN KIAA1218 protein OS=Homo sapiens OX=9606 GN=KIAA1218 PE=1 SV=1
2	Q9BTQ8	0.0	602	533	0.370	0.598	Q9BTQ8_HUMAN ATXN7L1 protein OS=Homo sapiens OX=9606 GN=ATXN7L1 PE=1 SV=2
3	Q9ULK2	0.0	1725	861	1.000	1.000	AT7L1_HUMAN Ataxin-7-like protein 1 OS=Homo sapiens OX=9606 GN=ATXN7L1 PE=1 SV=3
4	O15265	5.17e-119	384	892	0.382	0.369	ATX7_HUMAN Ataxin-7 OS=Homo sapiens OX=9606 GN=ATXN7 PE=1 SV=1
5	A0A2R8YDD6	1.03e-118	383	892	0.382	0.369	A0A2R8YDD6_HUMAN Ataxin 7 OS=Homo sapiens OX=9606 GN=ATXN7 PE=1 SV=1
6	Q8R4I1	3.04e-117	379	867	0.376	0.374	ATX7_MOUSE Ataxin-7 OS=Mus musculus OX=10090 GN=Atxn7 PE=1 SV=2
7	E7F640	3.93e-103	341	866	0.360	0.358	E7F640_DANRE Ataxin 7 OS=Danio rerio OX=7955 GN=atxn7 PE=4 SV=1
8	O94397	2.84e-11	68.2	344	0.052	0.131	SGF73_SCHPO SAGA-associated factor 73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sgf73 PE=3 SV=1
9	P53165	6.18e-08	58.9	657	0.035	0.046	SGF73_YEAST SAGA-associated factor 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGF73 PE=1 SV=1
10	Q14CW9	0.020	40.4	347	0.027	0.066	AT7L3_HUMAN Ataxin-7-like protein 3 OS=Homo sapiens OX=9606 GN=ATXN7L3 PE=1 SV=1
11	Q9VQB6	0.44	36.6	971	0.031	0.028	Q9VQB6_DROME Ataxin 7, isoform A OS=Drosophila melanogaster OX=7227 GN=Atxn7 PE=2 SV=1
12	Q54VB2	3.5	33.9	2935	0.031	0.009	Q54VB2_DICDI RapGAP/RanGAP domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280527 PE=4 SV=1
13	P30260	8.3	32.3	824	0.031	0.033	CDC27_HUMAN Cell division cycle protein 27 homolog OS=Homo sapiens OX=9606 GN=CDC27 PE=1 SV=2
14	G5EA36	8.4	32.3	823	0.031	0.033	G5EA36_HUMAN Cell division cycle 27 OS=Homo sapiens OX=9606 GN=CDC27 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12013 OrsD	89	15.0	Orsellinic acid/F9775 biosynthesis cluster protein D
2	PF08313 SCA7	1.1e-24	97.4	SCA7, zinc-binding domain
3	PF16135 TDBD	6.1e+02	11.9	Tify domain binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000410759

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000397259	0.976	Ataxin-7-like protein 3
2	9606.ENSP00000417510	0.897	SPT20 homolog, SAGA complex component
3	9606.ENSP00000307684	0.887	Transcriptional adapter 3
4	9606.ENSP00000360515	0.884	Transcription initiation protein SPT3 homolog
5	9606.ENSP00000263974	0.883	Transcription initiation factor TFIID subunit 12
6	9606.ENSP00000352925	0.883	Transformation/transcription domain-associated protein
7	9606.ENSP00000299424	0.841	Transcription initiation factor TFIID subunit 10
8	9606.ENSP00000294168	0.799	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L
9	9606.ENSP00000399982	0.799	Transcription initiation factor TFIID subunit 6
10	9606.ENSP00000308022	0.780	Transcriptional adapter 2-beta
11	9606.ENSP00000481091	0.780	Transcriptional adapter 2-alpha
12	9606.ENSP00000325634	0.756	Zinc finger protein 639
13	9606.ENSP00000339917	0.754	Transcription initiation factor TFIID subunit 9B
14	9606.ENSP00000370193	0.754	Transcription initiation factor TFIID subunit 9
15	9606.ENSP00000258281	0.736	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
16	9606.ENSP00000358854	0.736	Transcription initiation factor TFIID subunit 5
17	9606.ENSP00000360065	0.736	WD repeat-containing protein 78
18	9606.ENSP00000272317	0.726	Ubiquitin-40S ribosomal protein S27a
19	9606.ENSP00000388107	0.717	Ubiquitin-60S ribosomal protein L40
20	9606.ENSP00000226004	0.702	Dual specificity protein phosphatase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0009987	0.987	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0031326	0.976	regulation of cellular biosynthetic process
GO:0006807	0.975	nitrogen compound metabolic process
GO:0080090	0.966	regulation of primary metabolic process
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0010556	0.962	regulation of macromolecule biosynthetic process
GO:0043170	0.961	macromolecule metabolic process
GO:0019219	0.941	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.938	regulation of gene expression
GO:0051252	0.931	regulation of RNA metabolic process
GO:2001141	0.835	regulation of RNA biosynthetic process
GO:1903506	0.831	regulation of nucleic acid-templated transcription
GO:1901564	0.750	organonitrogen compound metabolic process
GO:0019538	0.738	protein metabolic process
GO:0006355	0.731	regulation of DNA-templated transcription
GO:0006357	0.666	regulation of transcription by RNA polymerase II
GO:0048519	0.661	negative regulation of biological process
GO:0044237	0.642	cellular metabolic process
GO:0043412	0.618	macromolecule modification
GO:0036211	0.597	protein modification process
GO:0048523	0.533	negative regulation of cellular process
GO:0048518	0.522	positive regulation of biological process
GO:0048522	0.474	positive regulation of cellular process
GO:0009893	0.454	positive regulation of metabolic process
GO:0016570	0.431	histone modification
GO:0010604	0.392	positive regulation of macromolecule metabolic process
GO:0071840	0.387	cellular component organization or biogenesis
GO:0018193	0.367	peptidyl-amino acid modification
GO:0016043	0.330	cellular component organization
GO:0051173	0.327	positive regulation of nitrogen compound metabolic process
GO:0031325	0.324	positive regulation of cellular metabolic process
GO:0070647	0.307	protein modification by small protein conjugation or removal
GO:0043543	0.300	protein acylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0043228	0.971	non-membrane-bounded organelle
GO:0005829	0.968	cytosol
GO:0043232	0.954	intracellular non-membrane-bounded organelle
GO:0032991	0.950	protein-containing complex
GO:0012505	0.354	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]