StarFunc result for job id Q9ULK4

User Input

>input (1368 residues)
METQLQSIFEEVVKTEVIEEAFPGMFMDTPEDEKTKLISCLGAFRQFWGGLSQESHEQCI
QWIVKFIHGQHSPKRISFLYDCLAMAVETGLLPPRLVCESLINSDTLEWERTQLWALTFK
LVRKIIGGVDYKGVRDLLKVILEKILTIPNTVSSAVVQQLLAAREVIAYILERNACLLPA
YFAVTEIRKLYPEGKLPHWLLGNLVSDFVDTFRPTARINSICGRCSLLPVVNNSGAICNS
WKLDPATLRFPLKGLLPYDKDLFEPQTALLRYVLEQPYSRDMVCNMLGLNKQHKQRCPVL
EDQLVDLVVYAMERSETEEKFDDGGTSQLLWQHLSSQLIFFVLFQFASFPHMVLSLHQKL
AGRGLIKGRDHLMWVLLQFISGSIQKNALADFLPVMKLFDLLYPEKEYIPVPDINKPQST
HAFAMTCIWIHLNRKAQNDNSKLQIPIPHSLRLHHEFLQQSLRNKSLQMNDYKIALLCNA
YSTNSECFTLPMGALVETIYGNGIMRIPLPGTNCMASGSITPLPMNLLDSLTVHAKMSLI
HSIATRVIKLAHAKSSVALAPALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGI
LHTLLEMFSYRMHHIQPHYRVQLLSHLHTLAAVAQTNQNQLHLCVESTALRLITALGSSE
VQPQFTRFLSDPKTVLSAESEELNRALILTLARATHVTDFFTGSDSIQGTWCKDILQTIM
SFTPHNWASHTLSCFPGPLQAFFKQNNVPQESRFNLKKNVEEEYRKWKSMSNENDIITHF
SMQGSPPLFLCLLWKMLLETDHINQIGYRVLERIGARALVAHVRTFADFLVYEFSTSAGG
QQLNKCIEILNDMVWKYNIVTLDRLILCLAMRSHEGNEAQVCYFIIQLLLLKPNDFRNRV
SDFVKENSPEHWLQNDWHTKHMNYHKKYPEKLYFEGLAEQVDPPVQIQSPYLPIYFGNVC
LRFLPVFDIVIHRFLELLPVSKSLETLLDHLGGLYKFHDRPVTYLYNTLHYYEMHLRDRA
FLKRKLVHAIIGSLKDNRPQGWCLSDTYLKCAMNAREENPWVPDDTYYCRLIGRLVDTMA
GKSPGPFPNCDWRFNEFPNPAAHALHVTCVELMALAVSGKEVGNALLNVVLKSQPLVPRE
NITAWMNAIGLIITALPEPYWIVLHDRIVSVISSPSLTSETEWVGYPFRLFDFTACHQSY
SEMSCSYTLALAHAVWHHSSIGQLSLIPKFLTEVLLPIVKTEFQLLYVYHLVGPFLQRFQ
QERTRCMIEIGVAFYDMLLNVDQCSTHLNYMDPICDFLYHMKYMFTGDSVKEQVEKIICN
LKPALKLRLRFITHISKMEPAAVPPQAMNSGSPAPQSNQVPVSLPVTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6h02A	0.949	0.973	0.000	1334	0.975	1.000	6h02A.pdb.gz
2	AFDB:Q5RIW8	0.964	0.958	0.000	1376	0.912	0.906	Q5RIW8.pdb.gz	MED23_DANRE Mediator of RNA polymerase II transcription subunit 23 OS=Danio rerio OX=7955 GN=med23 PE=2 SV=2
3	AFDB:Q9W1X7	0.921	0.876	1.924E-95	1439	0.478	0.454	Q9W1X7.pdb.gz	MED23_DROME Mediator of RNA polymerase II transcription subunit 23 OS=Drosophila melanogaster OX=7227 GN=MED23 PE=1 SV=1
4	PDB:6w1sR	0.872	0.919	2.821E-95	1295	0.910	0.961	6w1sR.pdb.gz	A Pliable Mediator Acts as a Functional Rather Than an Architectural Bridge between Promoters and Enhancers.
5	AFDB:Q10669	0.799	0.696	8.950E-40	1587	0.211	0.182	Q10669.pdb.gz	MED23_CAEEL Mediator of RNA polymerase II transcription subunit 23 OS=Caenorhabditis elegans OX=6239 GN=sur-2 PE=1 SV=1
6	AFDB:F4I4P3	0.707	0.608	1.183E-28	1615	0.181	0.154	F4I4P3.pdb.gz	MED23_ARATH Mediator of RNA polymerase II transcription subunit 23 OS=Arabidopsis thaliana OX=3702 GN=MED23 PE=1 SV=1
7	AFDB:Q55BN0	0.678	0.569	2.283E-27	1662	0.178	0.146	Q55BN0.pdb.gz	MED23_DICDI Putative mediator of RNA polymerase II transcription subunit 23 OS=Dictyostelium discoideum OX=44689 GN=med23 PE=3 SV=1
8	AFDB:A0A286YB81	0.114	0.106	4.962E-7	1565	0.118	0.103	A0A286YB81.pdb.gz
9	AFDB:Q54C50	0.126	0.094	7.889E-7	2043	0.147	0.098	Q54C50.pdb.gz	Q54C50_DICDI Armadillo-like helical domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1098 PE=4 SV=1
10	AFDB:Q42510	0.122	0.116	1.792E-6	1451	0.137	0.129	Q42510.pdb.gz	GNOM_ARATH ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana OX=3702 GN=GN PE=1 SV=1
11	AFDB:Q38AC2	0.101	0.077	4.863E-6	2432	0.131	0.074	Q38AC2.pdb.gz	Q38AC2_TRYB2 Serine/threonine-protein kinase TOR OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2060 PE=3 SV=1
12	AFDB:F4HRS2	0.103	0.080	5.223E-6	2222	0.161	0.099	F4HRS2.pdb.gz	SWTIE_ARATH Protein SWEETIE OS=Arabidopsis thaliana OX=3702 GN=SWEETIE PE=1 SV=2
13	PDB:6reyc	0.103	0.086	2.668E-5	1773	0.132	0.102	6reyc.pdb.gz	Characterization of Fully Recombinant Human 20S and 20S-PA200 Proteasome Complexes.
14	PDB:3w3uA	0.110	0.131	5.254E-5	1030	0.117	0.155	3w3uA.pdb.gz
15	PDB:6kwyc	0.133	0.115	5.445E-5	1811	0.135	0.102	6kwyc.pdb.gz	Cryo-EM structures of the human PA200 and PA200-20S complex reveal regulation of proteasome gate opening and two PA200 apertures.
16	PDB:7mqaLM	0.117	0.089	5.848E-5	2041	0.125	0.084	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7su3A	0.102	0.061	6.745E-5	3802	0.135	0.049	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
18	PDB:7w7gB	0.097	0.087	6.745E-5	1711	0.129	0.103	7w7gB.pdb.gz	Structure and mechanism of NALCN-FAM155A-UNC79-UNC80 channel complex.
19	PDB:7mvxA	0.097	0.088	8.354E-5	1645	0.139	0.116	7mvxA.pdb.gz
20	PDB:6x9oA	0.123	0.094	8.971E-5	2425	0.135	0.076	6x9oA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5EB59	0.0	2759	1367	0.966	0.967	MED23_RAT Mediator of RNA polymerase II transcription subunit 23 OS=Rattus norvegicus OX=10116 GN=Med23 PE=2 SV=2
2	Q5RIW8	0.0	2618	1376	0.912	0.907	MED23_DANRE Mediator of RNA polymerase II transcription subunit 23 OS=Danio rerio OX=7955 GN=med23 PE=2 SV=2
3	Q80YQ2	0.0	2726	1367	0.963	0.963	MED23_MOUSE Mediator of RNA polymerase II transcription subunit 23 OS=Mus musculus OX=10090 GN=Med23 PE=1 SV=2
4	Q9ULK4	0.0	2845	1368	1.000	1.000	MED23_HUMAN Mediator of RNA polymerase II transcription subunit 23 OS=Homo sapiens OX=9606 GN=MED23 PE=1 SV=2
5	Q9W1X7	0.0	1269	1439	0.480	0.457	MED23_DROME Mediator of RNA polymerase II transcription subunit 23 OS=Drosophila melanogaster OX=7227 GN=MED23 PE=1 SV=1
6	Q10669	4.42e-46	184	1587	0.215	0.185	MED23_CAEEL Mediator of RNA polymerase II transcription subunit 23 OS=Caenorhabditis elegans OX=6239 GN=sur-2 PE=1 SV=1
7	F4I4P3	5.06e-14	80.1	1615	0.114	0.097	MED23_ARATH Mediator of RNA polymerase II transcription subunit 23 OS=Arabidopsis thaliana OX=3702 GN=MED23 PE=1 SV=1
8	Q55BN0	0.003	45.1	1662	0.090	0.074	MED23_DICDI Putative mediator of RNA polymerase II transcription subunit 23 OS=Dictyostelium discoideum OX=44689 GN=med23 PE=3 SV=1
9	A0A0S2Z457	0.65	36.6	526	0.018	0.048	A0A0S2Z457_HUMAN Neutrophil cytosolic factor 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCF2 PE=2 SV=1
10	P19878	0.65	36.6	526	0.018	0.048	NCF2_HUMAN Neutrophil cytosol factor 2 OS=Homo sapiens OX=9606 GN=NCF2 PE=1 SV=2
11	Q9NU22	8.4	33.5	5596	0.036	0.009	MDN1_HUMAN Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11573 Med23	0	2059.7	Mediator complex subunit 23

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357047

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370938	0.997	Cyclin-dependent kinase 8
2	9606.ENSP00000286317	0.994	Mediator of RNA polymerase II transcription subunit 7
3	9606.ENSP00000300651	0.994	Mediator of RNA polymerase II transcription subunit 1
4	9606.ENSP00000323720	0.994	Mediator of RNA polymerase II transcription subunit 14
5	9606.ENSP00000258648	0.993	Mediator of RNA polymerase II transcription subunit 4
6	9606.ENSP00000325612	0.993	Mediator of RNA polymerase II transcription subunit 16
7	9606.ENSP00000362948	0.992	Mediator of RNA polymerase II transcription subunit 18
8	9606.ENSP00000326767	0.991	Mediator of RNA polymerase II transcription subunit 25
9	9606.ENSP00000363193	0.991	Mediator of RNA polymerase II transcription subunit 12
10	9606.ENSP00000255764	0.990	Mediator of RNA polymerase II transcription subunit 10
11	9606.ENSP00000337340	0.990	Mediator of RNA polymerase II transcription subunit 19
12	9606.ENSP00000352673	0.989	ETS-related transcription factor Elf-3
13	9606.ENSP00000357907	0.988	Cyclin dependent kinase 19
14	9606.ENSP00000380888	0.985	Mediator of RNA polymerase II transcription subunit 13
15	9606.ENSP00000482438	0.985	Mediator of RNA polymerase II transcription subunit 22
16	9606.ENSP00000428982	0.984	Cyclin-C
17	9606.ENSP00000263205	0.982	Mediator of RNA polymerase II transcription subunit 15
18	9606.ENSP00000263390	0.980	Mediator of RNA polymerase II transcription subunit 26
19	9606.ENSP00000377686	0.980	Mediator of RNA polymerase II transcription subunit 24
20	9606.ENSP00000282892	0.972	Mediator of RNA polymerase II transcription subunit 21

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:0003824	0.906	catalytic activity
GO:0140096	0.875	catalytic activity, acting on a protein
GO:0019787	0.871	ubiquitin-like protein transferase activity
GO:0061659	0.796	ubiquitin-like protein ligase activity
GO:0004842	0.770	ubiquitin-protein transferase activity
GO:0061630	0.723	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.981	primary metabolic process
GO:0006807	0.981	nitrogen compound metabolic process
GO:0043170	0.981	macromolecule metabolic process
GO:0050794	0.980	regulation of cellular process
GO:0060255	0.967	regulation of macromolecule metabolic process
GO:0010468	0.963	regulation of gene expression
GO:0048518	0.961	positive regulation of biological process
GO:0009987	0.943	cellular process
GO:0080090	0.935	regulation of primary metabolic process
GO:0051252	0.932	regulation of RNA metabolic process
GO:0044237	0.925	cellular metabolic process
GO:0009889	0.906	regulation of biosynthetic process
GO:0010556	0.904	regulation of macromolecule biosynthetic process
GO:0031326	0.904	regulation of cellular biosynthetic process
GO:2001141	0.890	regulation of RNA biosynthetic process
GO:0006351	0.879	DNA-templated transcription
GO:0006355	0.869	regulation of DNA-templated transcription
GO:0048522	0.828	positive regulation of cellular process
GO:0006357	0.827	regulation of transcription by RNA polymerase II
GO:0010604	0.824	positive regulation of macromolecule metabolic process
GO:0043412	0.763	macromolecule modification
GO:0002682	0.713	regulation of immune system process
GO:1901564	0.708	organonitrogen compound metabolic process
GO:0036211	0.695	protein modification process
GO:0031325	0.670	positive regulation of cellular metabolic process
GO:0002691	0.663	regulation of cellular extravasation
GO:0006352	0.640	DNA-templated transcription initiation
GO:2000401	0.625	regulation of lymphocyte migration
GO:0051173	0.622	positive regulation of nitrogen compound metabolic process
GO:0048519	0.610	negative regulation of biological process
GO:0070647	0.610	protein modification by small protein conjugation or removal
GO:0009891	0.607	positive regulation of biosynthetic process
GO:0006366	0.600	transcription by RNA polymerase II
GO:0048523	0.598	negative regulation of cellular process
GO:0051254	0.585	positive regulation of RNA metabolic process
GO:0045893	0.581	positive regulation of DNA-templated transcription
GO:0045944	0.475	positive regulation of transcription by RNA polymerase II
GO:0002687	0.455	positive regulation of leukocyte migration
GO:0071677	0.452	positive regulation of mononuclear cell migration
GO:0050793	0.318	regulation of developmental process
GO:2000404	0.302	regulation of T cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0005667	0.937	transcription regulator complex
GO:0016592	0.936	mediator complex
GO:0090575	0.931	RNA polymerase II transcription regulator complex
GO:0070847	0.872	core mediator complex
GO:1902494	0.870	catalytic complex
GO:1990234	0.434	transferase complex
GO:0140535	0.425	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.871	Transferases.

[back to server]