StarFunc result for job id Q9ULL0

User Input

>input (1709 residues)
MRAGWTPRGFSAFHASLLPGRHPYLAHLGPRDRGARIGSRAYSQGCCSCLWLTYKGKKEG
STKGELGPAAVTDLEIPSYSRGFLPCTPRFPTTWCRGPGCFCGTAVIAGNLGDLARIVGP
SHHASQLLLLQEQDSGNHPTMAESLSEISDSLDVLEAGDEGKKKCKFKALKSFFVKKKEK
EAEDTQEEEMLELSLSSSNINISSLQPVRENQPTKARAKSSMGSKALSHDSIFMLGPEPE
RSASKMFPSMDPQRGRPQQRSHISRTLPKPRSKVPGVVSGAMSGAVLQNVPTSAVWVAGP
KITENPPSRRRRLSIIPPVIQPEIISKNLVEISLDDESPKNPQKKALPHKSLTATQSFSE
LSSGPDCSQSLTAFATLASTSSTQLPIGFSTPATTQGCLDSSAARHKMTLNPRKQKKNLQ
VIIRGLPVWFSHFQGILEGSLQCVTQTLETPNLDEPLPVEPKEEEPNLPLVSEEEKSITK
PKEINEKKLGMDSADSSSQKQNNKTEMYDKKTTDQAPNTDASRSQGYPMSAAYGRRWRRK
GASVSGLSGCEFKGRSLKQSSEGYGLGDRAGSSPTNKTARNVPFSHLSLEKDNMEQPTTS
QPETTTPQGLLSDKDDMGRRNAGIDFGSRKASAAQPIPENMDNSMVSDPQPYHEDAASGA
EKTEARASLSLMVESLSTTQEEAILSVAAEAQVFMNPSHIQLEDQEAFSFDLQKAQSKME
SAQDVQTICKEKPSGNVHQTFTASVLGMTSTTAKGDVYAKTLPPRSLFQSSRKPDAEEVS
SDSENIPEEGDGSEELAHGHSSQSLGKFEDEQEVFSESKSFVEDLSSSEEELDLRCLSQA
LEEPEDAEVFTESSSYVEKYNTSDDCSSSEEDLPLRHPAQALGKPKNQQEVSSASNNTPE
EQNDFMQQLPSRCPSQPIMNPTVQQQVPTSSVGTSIKQSDSVEPIPPRHPFQPWVNPKVE
QEVSSSPKSMAVEESISMKPLPPKLLCQPLMNPKVQQNMFSGSEDIAVERVISVEPLLPR
YSPQSLTDPQIRQISESTAVEEGTYVEPLPPRCLSQPSERPKFLDSMSTSAEWSSPVAPT
PSKYTSPPWVTPKFEELYQLSAHPESTTVEEDISKEQLLPRHLSQLTVGNKVQQLSSNFE
RAAIEADISGSPLPPQYATQFLKRSKVQEMTSRLEKMAVEGTSNKSPIPRRPTQSFVKFM
AQQIFSESSALKRGSDVAPLPPNLPSKSLSKPEVKHQVFSDSGSANPKGGISSKMLPMKH
PLQSLGRPEDPQKVFSYSERAPGKCSSFKEQLSPRQLSQALRKPEYEQKVSPVSASSPKE
WRNSKKQLPPKHSSQASDRSKFQPQMSSKGPVNVPVKQSSGEKHLPSSSPFQQQVHSSSV
NAAARRSVFESNSDNWFLGRDEAFAIKTKKFSQGSKNPIKSIPAPATKPGKFTIAPVRQT
STSGGIYSKKEDLESGDGNNNQHANLSNQDDVEKLFGVRLKRAPPSQKYKSEKQDNFTQL
ASVPSGPISSSVGRGHKIRSTSQGLLDAAGNLTKISYVADKQQSRPKSESMAKKQPACKT
PGKPAGQQSDYAVSEPVWITMAKQKQKSFKAHISVKELKTKSNAGADAETKEPKYEGAGS
ANENQPKKMFTSSVHKQEKTAQMKPPKPTKSVGFEAQKILQVPAMEKETKRSSTLPAKFQ
NPVEPIEPVWFSLARKKAKAWSHMAEITQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q0C6	0.031	0.032	4.279E-16	1637	0.301	0.315	E9Q0C6.pdb.gz	K1210_MOUSE Acrosomal protein KIAA1210 OS=Mus musculus OX=10090 GN=Kiaa1210 PE=1 SV=1
2	AFDB:Q5VWN6	0.034	0.025	4.006E-3	2430	0.160	0.113	Q5VWN6.pdb.gz	TASO2_HUMAN Protein TASOR 2 OS=Homo sapiens OX=9606 GN=TASOR2 PE=1 SV=1
3	AFDB:Q99KW3	0.030	0.027	5.953E-3	2014	0.160	0.136	Q99KW3.pdb.gz	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3
4	AFDB:P13709	0.027	0.025	8.846E-3	2038	0.138	0.116	P13709.pdb.gz	FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster OX=7227 GN=fs(1)h PE=1 SV=2
5	AFDB:A0A0B4K7S6	0.029	0.026	1.037E-2	1965	0.149	0.130	A0A0B4K7S6.pdb.gz	A0A0B4K7S6_DROME Molting defective, isoform D OS=Drosophila melanogaster OX=7227 GN=mld PE=4 SV=1
6	AFDB:Q5VV67	0.028	0.028	1.122E-2	1664	0.160	0.165	Q5VV67.pdb.gz	PPRC1_HUMAN Peroxisome proliferator-activated receptor gamma coactivator-related protein 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
7	AFDB:Q9VWC0	0.035	0.027	1.122E-2	2529	0.155	0.105	Q9VWC0.pdb.gz	Q9VWC0_DROME Histone gene-specific epigenetic repressor in late S phase, isoform A OS=Drosophila melanogaster OX=7227 GN=Hers PE=4 SV=2
8	AFDB:Q6ZU65	0.026	0.030	8.801E-2	1347	0.123	0.157	Q6ZU65.pdb.gz	UBN2_HUMAN Ubinuclein-2 OS=Homo sapiens OX=9606 GN=UBN2 PE=1 SV=2
9	AFDB:Q9NZM4	0.026	0.028	9.527E-2	1560	0.150	0.164	Q9NZM4.pdb.gz	BICRA_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein OS=Homo sapiens OX=9606 GN=BICRA PE=1 SV=2
10	AFDB:F4JP43	0.030	0.026	1.659E-1	2037	0.154	0.129	F4JP43.pdb.gz	F4JP43_ARATH G2484-1 protein OS=Arabidopsis thaliana OX=3702 GN=G2484-1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q0C6	5.26e-44	178	1637	0.108	0.113	K1210_MOUSE Acrosomal protein KIAA1210 OS=Mus musculus OX=10090 GN=Kiaa1210 PE=1 SV=1
2	Q5PR69	2.76e-04	48.5	1291	0.029	0.038	CRACD_MOUSE Capping protein-inhibiting regulator of actin dynamics OS=Mus musculus OX=10090 GN=Cracd PE=1 SV=4
3	Q6ZU35	0.001	46.6	1233	0.029	0.040	CRACD_HUMAN Capping protein-inhibiting regulator of actin dynamics OS=Homo sapiens OX=9606 GN=CRACD PE=1 SV=3
4	P34529	1.4	36.2	1910	0.011	0.009	DCR1_CAEEL Endoribonuclease dcr-1 OS=Caenorhabditis elegans OX=6239 GN=dcr-1 PE=1 SV=3
5	Q0KI42	3.5	35.0	897	0.011	0.021	Q0KI42_DROME FI04462p OS=Drosophila melanogaster OX=7227 GN=GluRIIE PE=2 SV=1
6	Q9LV85	4.5	34.3	564	0.015	0.046	CPR5_ARATH Protein CPR-5 OS=Arabidopsis thaliana OX=3702 GN=CPR5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15262 DUF4592	1.3e-10	53.3	Domain of unknown function (DUF4592)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384670

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360485	0.804	A-kinase anchor protein 14
2	9606.ENSP00000364035	0.752	Fatty-acid amide hydrolase 2
3	9606.ENSP00000369465	0.697	Gamma-taxilin
4	9606.ENSP00000438863	0.680	Proton-activated chloride channel that mediates import of chloride ion in response to extracellular acidic pH (PubMed:31023925, PubMed:31318332). Involved in acidosis-induced cell death by mediating chloride influx and subsequent cell swelling (PubMed:31023925, PubMed:31318332)
5	9606.ENSP00000321179	0.651	RNA-binding protein 44
6	9606.ENSP00000439182	0.636	Unconventional myosin-Ih
7	9606.ENSP00000324827	0.619	A-kinase anchor protein 17A
8	9606.ENSP00000264255	0.617	Thioredoxin domain-containing protein 9
9	9606.ENSP00000322845	0.616	Zinc finger MYM-type protein 3
10	9606.ENSP00000355198	0.595	Melanoma-associated antigen B3
11	9606.ENSP00000362021	0.581	Transmembrane protein 35A
12	9606.ENSP00000377699	0.560	Adhesion G-protein coupled receptor G4
13	9606.ENSP00000289359	0.558	MIT domain-containing protein 1
14	9606.ENSP00000356575	0.530	Transcription factor HIVEP2
15	9606.ENSP00000321997	0.520	La-related protein 1B
16	9606.ENSP00000300255	0.507	Protein eva-1 homolog C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.982	cellular process
GO:0050794	0.980	regulation of cellular process
GO:0071840	0.522	cellular component organization or biogenesis
GO:0016043	0.510	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0030054	0.914	cell junction
GO:0005634	0.846	nucleus
GO:0016020	0.822	membrane
GO:0012505	0.804	endomembrane system
GO:0005886	0.520	plasma membrane
GO:0031974	0.423	membrane-enclosed lumen
GO:0031982	0.414	vesicle
GO:0005829	0.358	cytosol
GO:0070013	0.355	intracellular organelle lumen
GO:0031981	0.316	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]