StarFunc result for job id Q9ULL1

User Input

>input (1385 residues)
MELSDSDRPVSFGSTSSSASSRDSHGSFGSRMTLVSNSHMGLFNQDKEVGAIKLELIPAR
PFSSSELQRDNPATGQQNADEGSERPPRAQWRVDSNGAPKTIADSATSPKLLYVDRVVQE
ILETERTYVQDLKSIVEDYLDCIRDQTKLPLGTEERSALFGNIQDIYHFNSELLQDLENC
ENDPVAIAECFVSKSEEFHIYTQYCTNYPRSVAVLTECMRNKILAKFFRERQETLKHSLP
LGSYLLKPVQRILKYHLLLHEIENHLDKDTEGYDVVLDAIDTMQRVAWHINDMKRKHEHA
VRLQEIQSLLTNWKGPDLTSYGELVLEGTFRIQRAKNERTLFLFDKLLLITKKRDDTFTY
KAHILCGNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWVLHLKRLILENHA
AKIPAKAKQAILEMDAIHHPGFCYSPEGGTKALFGSKEGSAPYRLRRKSEPSSRSHKVLK
TSETAQDIQKVSREEGSPQLSSARPSPAQRNSQPSSSTMISVLRAGGALRNIWTDHQIRQ
ALFPSRRSPQENEDDEDDYQMFVPSFSSSDLNSTRLCEDSTSSRPCSWHMGQMESTETSS
SGHRIVRRASSAGESNTCPPEIGTSDRTRELQNSPKTEGQEEMTPFGSSIELTIDDIDHV
YDNISYEDLKLMVAKREEAESTPSKSARDSVRPKSTPELAFTKRQAGHSKGSLYAQTDGT
LSGGEASSQSTHELQAVEENIYDTIGLPDPPSLGFKCSSLKRAKRSTFLGLEADFVCCDS
LRPFVSQDSLQLSEDEAPYHQATPDHGYLSLLYDSPSGNLSMPHKPVSDKLSEEVDEIWN
DLENYIKKNEDKARDRLLAAFPVSKDDVPDRLHAESTPELSRDVGRSVSTLSLPESQALL
TPVKSRAGRASRANCPFEEDLISKEGSFMSLNRLSLASEMPLMDNPYDLANSGLSQTDPE
NPDLGMEATDKTKSRVFMMARQYSQKIKKANQLLKVKSLELEQPPASQHQKSMHKDLAAI
LEEKKQGGPAIGARIAEYSQLYDQIVFRESPLKIQKDGWASPQESSLLRSVSPSQVHHGS
GDWLLHSTYSNGELADFCLPPEQDLRSRYPTFEINTKSTPRQLSAACSVPSLQTSDPLPG
SVQRCSVVVSQPNKENWCQDHLYNSLGRKGISAKSQPYHRSQSSSSVLINKSMDSINYPS
DVGKQQLLSLHRSSRCESHQDLLPDIADSHQQGTEKLSDLTLQDSQKVVVVNRNLPLNAQ
IATQNYFSNFKETDGDEDDYVEIKSEEDESELELSHNRRRKSDSKFVDADFSDNVCSGNT
LHSLNSPRTPKKPVNSKLGLSPYLTPYNDSDKLNDYLWRGPSPNQQNIVQSLREKFQCLS
SSSFA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULL1	1.000	1.000	0.000	1385	1.000	1.000	Q9ULL1.pdb.gz	PKHG1_HUMAN Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=1 SV=2
2	PDB:4mt6A	0.186	0.554	2.672E-18	389	0.062	0.221	4mt6A.pdb.gz
3	PDB:7rx9A	0.130	0.407	5.715E-18	432	0.069	0.220	7rx9A.pdb.gz
4	AFDB:A8DZ19	0.169	0.177	6.682E-16	1310	0.138	0.146	A8DZ19.pdb.gz	A8DZ19_DROME Rho-type guanine nucleotide exchange factor, isoform F OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=2
5	PDB:4gouA	0.119	0.309	9.563E-9	507	0.034	0.093	4gouA.pdb.gz
6	PDB:5yqrA	0.073	0.336	1.445E-3	268	0.026	0.134	5yqrA.pdb.gz
7	AFDB:G3V874	0.071	0.094	3.959E-3	963	0.079	0.113	G3V874.pdb.gz	G3V874_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=4 SV=1
8	AFDB:A8C4G9	0.066	0.073	6.367E-3	1208	0.118	0.136	A8C4G9.pdb.gz	A8C4G9_RAT Spikar OS=Rattus norvegicus OX=10116 GN=Zmynd8 PE=1 SV=1
9	PDB:6u3eA	0.065	0.193	6.609E-3	397	0.043	0.149	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
10	AFDB:Q5SYB0	0.079	0.071	7.001E-3	1578	0.131	0.115	Q5SYB0.pdb.gz	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
11	AFDB:Q38AE6	0.060	0.069	7.699E-3	1203	0.108	0.125	Q38AE6.pdb.gz	Q38AE6_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2340 PE=4 SV=1
12	AFDB:Q9Z0Y7	0.067	0.073	8.879E-3	1216	0.103	0.118	Q9Z0Y7.pdb.gz	IRS4_MOUSE Insulin receptor substrate 4 OS=Mus musculus OX=10090 GN=Irs4 PE=1 SV=2
13	AFDB:Q6PAC4	0.046	0.050	1.074E-2	1279	0.156	0.169	Q6PAC4.pdb.gz	PCARE_MOUSE Photoreceptor cilium actin regulator OS=Mus musculus OX=10090 GN=Pcare PE=2 SV=1
14	AFDB:O14654	0.073	0.079	1.181E-2	1257	0.108	0.119	O14654.pdb.gz	IRS4_HUMAN Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1
15	PDB:4mk0A	0.062	0.124	1.226E-2	631	0.018	0.040	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	PDB:6hhgA	0.062	0.206	2.749E-2	386	0.009	0.034	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
17	AFDB:Q9DF49	0.074	0.091	3.202E-2	1074	0.105	0.136	Q9DF49.pdb.gz	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
18	PDB:2kr0A	0.062	0.179	7.455E-2	407	0.022	0.076	2kr0A.pdb.gz
19	PDB:7lpsA	0.041	0.067	1.143E-1	781	0.010	0.018	7lpsA.pdb.gz	Acute pharmacological degradation of Helios destabilizes regulatory T cells.
20	PDB:5yfpH	0.097	0.214	2.022E-1	518	0.025	0.066	5yfpH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JYA6	0.0	2865	1385	1.000	1.000	Q5JYA6_HUMAN PLEKHG1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=2 SV=1
2	Q9ULL1	0.0	2865	1385	1.000	1.000	PKHG1_HUMAN Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=1 SV=2
3	A1L390	9.22e-148	483	1219	0.171	0.194	PKHG3_HUMAN Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3 PE=1 SV=1
4	Q9H7P9	1.90e-97	345	1386	0.136	0.136	PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens OX=9606 GN=PLEKHG2 PE=1 SV=3
5	D4YWB8	2.86e-71	257	775	0.102	0.182	D4YWB8_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uig-1 PE=1 SV=1
6	Q9XXM9	2.15e-70	258	919	0.102	0.153	Q9XXM9_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uig-1 PE=1 SV=1
7	G5EER5	3.36e-70	258	952	0.102	0.148	G5EER5_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uig-1 PE=1 SV=1
8	G5EF62	3.82e-70	258	972	0.102	0.145	G5EF62_CAEEL Protein vav OS=Caenorhabditis elegans OX=6239 GN=uig-1 PE=1 SV=1
9	B6GUP8	4.50e-70	257	958	0.102	0.147	B6GUP8_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uig-1 PE=1 SV=1
10	A0A0B4KFB7	1.13e-65	243	878	0.093	0.147	A0A0B4KFB7_DROME Guanine nucleotide exchange factor in mesoderm, isoform F OS=Drosophila melanogaster OX=7227 GN=GEFmeso PE=4 SV=1
11	A1ZBA1	6.41e-65	245	1549	0.093	0.083	A1ZBA1_DROME FI17866p1 OS=Drosophila melanogaster OX=7227 GN=GEFmeso PE=2 SV=2
12	B3DN64	1.30e-64	243	1237	0.093	0.104	B3DN64_DROME Guanine nucleotide exchange factor in mesoderm, isoform G OS=Drosophila melanogaster OX=7227 GN=GEFmeso PE=2 SV=1
13	Q8MSP7	1.36e-64	243	1240	0.093	0.104	Q8MSP7_DROME AT03020p OS=Drosophila melanogaster OX=7227 GN=GEFmeso PE=2 SV=1
14	Q6PDM6	6.61e-34	144	1166	0.071	0.085	Q6PDM6_MOUSE Mcf.2 transforming sequence-like OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=1
15	Q63406	6.95e-34	144	1149	0.071	0.086	MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus OX=10116 GN=Mcf2l PE=1 SV=3
16	O15068	1.29e-33	143	1137	0.071	0.086	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2
17	A0A2R8RHL8	2.30e-33	143	2306	0.075	0.045	A0A2R8RHL8_DANRE Kalirin RhoGEF kinase b OS=Danio rerio OX=7955 GN=wu:fc60a10 PE=4 SV=1
18	Q64096	7.58e-33	141	1149	0.071	0.085	MCF2L_MOUSE Guanine nucleotide exchange factor DBS OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=2
19	Q99N72	3.68e-32	138	928	0.074	0.111	Q99N72_MOUSE Mcf2 proto-oncogene protein OS=Mus musculus OX=10090 GN=Mcf2 PE=1 SV=1
20	Q7TNJ5	4.48e-32	138	944	0.074	0.109	Q7TNJ5_MOUSE Mcf2 proto-oncogene protein OS=Mus musculus OX=10090 GN=Mcf2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16453 IQ_SEC7_PH	27	16.1	PH domain
2	PF00169 PH	0.34	22.8	PH domain
3	PF15411 PH_10	12	17.5	Pleckstrin homology domain
4	PF00621 RhoGEF	1.5e-41	154.1	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356297

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341360	0.709	Cordon-bleu WH2 repeat protein like 1
2	9606.ENSP00000254051	0.694	Tensin-4
3	9606.ENSP00000375067	0.691	Breast carcinoma-amplified sequence 3
4	9606.ENSP00000304032	0.620	StAR-related lipid transfer protein 5
5	9606.ENSP00000002596	0.606	Heparan sulfate glucosamine 3-O-sulfotransferase 1
6	9606.ENSP00000262717	0.599	Cadherin-20
7	9606.ENSP00000297737	0.586	Zinc finger matrin-type 4
8	9606.ENSP00000383118	0.567	Cell division control protein 42 homolog
9	9606.ENSP00000327025	0.558	Nuclear receptor ROR-gamma
10	9606.ENSP00000274710	0.540	Pleckstrin and Sec7 domain containing 2
11	9606.ENSP00000468678	0.539	Pleckstrin homology, MyTH4 and FERM domain containing H3
12	9606.ENSP00000393161	0.535	Transmembrane protein 151B
13	9606.ENSP00000364986	0.529	Agmatinase, mitochondrial
14	9606.ENSP00000323183	0.519	Zinc finger and BTB domain-containing protein 2
15	9606.ENSP00000356263	0.519	Protein-glutamate O-methyltransferase
16	9606.ENSP00000478253	0.519	Monofunctional C1-tetrahydrofolate synthase, mitochondrial
17	9606.ENSP00000239374	0.517	Coiled-coil domain containing 170
18	9606.ENSP00000394794	0.509	Tyrosine-protein phosphatase non-receptor type 13
19	9606.ENSP00000439479	0.507	DmX-like protein 1
20	9606.ENSP00000239587	0.505	Probable tubulin polyglutamylase TTLL2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0005515	0.994	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009966	0.971	regulation of signal transduction
GO:1902531	0.960	regulation of intracellular signal transduction
GO:0051056	0.922	regulation of small GTPase mediated signal transduction
GO:0009987	0.646	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.989	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]