StarFunc result for job id Q9ULL4

User Input

>input (1909 residues)
MCHAAQETPLLHHFMAPVMARWPPFGLCLLLLLLSPPPLPLTGAHRFSAPNTTLNHLALA
PGRGTLYVGAVNRLFQLSPELQLEAVAVTGPVIDSPDCVPFRDPAECPQAQLTDNANQLL
LVSSRAQELVACGQVRQGVCETRRLGDVAEVLYQAEDPGDGQFVAANTPGVATVGLVVPL
PGRDLLLVARGLAGKLSAGVPPLAIRQLAGSQPFSSEGLGRLVVGDFSDYNNSYVGAFAD
ARSAYFVFRRRGARAQAEYRSYVARVCLGDTNLYSYVEVPLACQGQGLIQAAFLAPGTLL
GVFAAGPRGTQAALCAFPMVELGASMEQARRLCYTAGGRGPSGAEEATVEYGVTSRCVTL
PLDSPESYPCGDEHTPSPIAGRQPLEVQPLLKLGQPVSAVAALQADGHMIAFLGDTQGQL
YKVFLHGSQGQVYHSQQVGPPGSAISPDLLLDSSGSHLYVLTAHQVDRIPVAACPQFPDC
ASCLQAQDPLCGWCVLQGRCTRKGQCGRAGQLNQWLWSYEEDSHCLHIQSLLPGHHPRQE
QGQVTLSVPRLPILDADEYFHCAFGDYDSLAHVEGPHVACVTPPQDQVPLNPPGTDHVTV
PLALMFEDVTVAATNFSFYDCSAVQALEAAAPCRACVGSIWRCHWCPQSSHCVYGEHCPE
GERTIYSAQEVDIQVRGPGACPQVEGLAGPHLVPVGWESHLALRVRNLQHFRGLPASFHC
WLELPGELRGLPATLEETAGDSGLIHCQAHQFYPSMSQRELPVPIYVTQGEAQRLDNTHA
LYVILYDCAMGHPDCSHCQAANRSLGCLWCADGQPACRYGPLCPPGAVELLCPAPSIDAV
EPLTGPPEGGLALTILGSNLGRAFADVQYAVSVASRPCNPEPSLYRTSARIVCVTSPAPN
GTTGPVRVAIKSQPPGISSQHFTYQDPVLLSLSPRWGPQAGGTQLTIRGQHLQTGGNTSA
FVGGQPCPILEPVCPEAIVCRTRPQAAPGEAAVLVVFGHAQRTLLASPFRYTANPQLVAA
EPSASFRGGGRLIRVRGTGLDVVQRPLLSVWLEADAEVQASRAQPQDPQPRRSCGAPAAD
PQACIQLGGGLLQCSTVCSVNSSSLLLCRSPAVPDRAHPQRVFFTLDNVQVDFASASGGQ
GFLYQPNPRLAPLSREGPARPYRLKPGHVLDVEGEGLNLGISKEEVRVHIGRGECLVKTL
TRTHLYCEPPAHAPQPANGSGLPQFVVQMGNVQLALGPVQYEAEPPLSAFPVEAQAGVGM
GAAVLIAAVLLLTLMYRHKSKQALRDYQKVLVQLESLETGVGDQCRKEFTDLMTEMTDLS
SDLEGSGIPFLDYRTYAERAFFPGHGGCPLQPKPEGPGEDGHCATVRQGLTQLSNLLNSK
LFLLTLIHTLEEQPSFSQRDRCHVASLLSLALHGKLEYLTDIMRTLLGDLAAHYVHRNPK
LMLRRTETMVEKLLTNWLSICLYAFLREVAGEPLYMLFRAIQYQVDKGPVDAVTGKAKRT
LNDSRLLREDVEFQPLTLMVLVGPGAGGAAGSSEMQRVPARVLDTDTITQVKEKVLDQVY
KGTPFSQRPSVHALDLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGATVGL
VPQLHRGSTISQSLAQRCPLGENIPTLEDGEEGGVCLWHLVKATEEPEGAKVRCSSLRER
EPARAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSVNRPIPIAVKYLFDLLDELAEKHG
IEDPGTLHIWKTNSLLLRFWVNALKNPQLIFDVRVSDNVDAILAVIAQTFIDSCTTSEHK
VGRDSPVNKLLYAREIPRYKQMVERYYADIRQSSPASYQEMNSALAELSGNYTSAPHCLE
ALQELYNHIHRYYDQIISALEEDPVGQKLQLACRLQQVAALVENKVTDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IRZ9	0.580	0.570	0.000	1945	0.427	0.420	A0A0R4IRZ9.pdb.gz
2	AFDB:A0A2R8QPJ6	0.659	0.661	0.000	1902	0.334	0.335	A0A2R8QPJ6.pdb.gz	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
3	AFDB:B0S5N4	0.544	0.548	0.000	1892	0.337	0.340	B0S5N4.pdb.gz	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
4	AFDB:B2RXS4	0.551	0.567	0.000	1842	0.387	0.401	B2RXS4.pdb.gz	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
5	AFDB:D3ZLH5	0.780	0.783	0.000	1902	0.846	0.849	D3ZLH5.pdb.gz	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
6	AFDB:F1Q7U0	0.508	0.444	0.000	2220	0.501	0.431	F1Q7U0.pdb.gz	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
7	AFDB:F1QBC0	0.500	0.510	0.000	1864	0.367	0.376	F1QBC0.pdb.gz	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
8	AFDB:O15031	0.595	0.613	0.000	1838	0.390	0.405	O15031.pdb.gz	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
9	AFDB:O43157	0.537	0.484	0.000	2135	0.522	0.467	O43157.pdb.gz	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
10	AFDB:O45657	0.405	0.428	0.000	1766	0.250	0.270	O45657.pdb.gz	PLX2_CAEEL Plexin-2 OS=Caenorhabditis elegans OX=6239 GN=plx-2 PE=1 SV=5
11	PDB:6vxkB	0.208	0.493	2.535E-27	747	0.084	0.216	6vxkB.pdb.gz
12	PDB:6qp7A	0.189	0.527	1.991E-19	620	0.051	0.156	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
13	PDB:3nvqA	0.186	0.534	2.258E-17	588	0.059	0.192	3nvqA.pdb.gz
14	PDB:3nvnA	0.141	0.600	9.661E-12	383	0.034	0.167	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
15	PDB:7sqcO0	0.071	0.099	2.208E-9	1140	0.043	0.072	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:4g1eA	0.107	0.181	1.518E-8	964	0.060	0.119	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
17	PDB:5a42A	0.078	0.089	1.586E-8	1597	0.065	0.078	5a42A.pdb.gz
18	PDB:1e07A	0.062	0.133	2.457E-8	642	0.036	0.107	1e07A.pdb.gz
19	PDB:5e7gA	0.087	0.230	6.165E-8	446	0.035	0.150	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
20	PDB:6xk9Y	0.113	0.173	7.346E-8	1106	0.058	0.100	6xk9Y.pdb.gz	CC-90009, a novel cereblon E3 ligase modulator, targets acute myeloid leukemia blasts and leukemia stem cells.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QPJ6	966	1902	0.343	0.344	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
2	A8IYK2	931	1885	0.334	0.338	A8IYK2_DANRE Plexin-A1 OS=Danio rerio OX=7955 GN=plxna1 PE=1 SV=1
3	B0S5N4	924	1892	0.337	0.340	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
4	B2RXS4	1189	1842	0.401	0.416	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
5	C5H5I1	1177	1864	0.377	0.386	C5H5I1_DANRE Plexin B2 OS=Danio rerio OX=7955 GN=plxnB2 PE=1 SV=1
6	D3ZLH5	3227	1902	0.834	0.838	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
7	F1Q7U0	1283	2220	0.354	0.305	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
8	F1QBC0	1175	1864	0.375	0.384	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
9	H9XVP3	993	1928	0.339	0.336	H9XVP3_DROME Plexin A, isoform F OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
10	O15031	1231	1838	0.403	0.419	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
11	O43157	1266	2135	0.361	0.323	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
12	O75051	969	1894	0.348	0.351	PLXA2_HUMAN Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 SV=4
13	O96681	986	1945	0.340	0.334	O96681_DROME Plexin A OS=Drosophila melanogaster OX=7227 GN=PlexA PE=2 SV=1
14	P51805	902	1871	0.336	0.343	PLXA3_HUMAN Plexin-A3 OS=Homo sapiens OX=9606 GN=PLXNA3 PE=1 SV=3
15	P70206	950	1894	0.348	0.351	PLXA1_MOUSE Plexin-A1 OS=Mus musculus OX=10090 GN=Plxna1 PE=1 SV=1
16	P70207	968	1894	0.349	0.352	PLXA2_MOUSE Plexin-A2 OS=Mus musculus OX=10090 GN=Plxna2 PE=1 SV=2
17	P70208	921	1872	0.338	0.345	PLXA3_MOUSE Plexin-A3 OS=Mus musculus OX=10090 GN=Plxna3 PE=1 SV=2
18	Q0KIF1	861	1505	0.283	0.359	Q0KIF1_DROME Plexin A, isoform B OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
19	Q3UH93	951	1925	0.358	0.355	PLXD1_MOUSE Plexin-D1 OS=Mus musculus OX=10090 GN=Plxnd1 PE=1 SV=1
20	Q3V5K0	781	1945	0.305	0.300	Q3V5K0_CAEEL Sema domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=plx-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08337 Plexin_cytopl	3e-170	578.5	Plexin cytoplasmic RasGAP domain
2	PF20170 Plexin_RBD	2.8e-39	145.2	Plexin cytoplasmic RhoGTPase-binding domain
3	PF01437 PSI	1.1e-12	59.5	Plexin repeat
4	PF01403 Sema	3.9e-10	51.4	Sema domain
5	PF01833 TIG	5e-31	118.0	IPT/TIG domain
6	PF18020 TIG_2	6.3e-16	70.1	TIG domain found in plexin
7	PF17960 TIG_plexin	5.3e-19	79.2	TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000442736

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000002829	0.991	Semaphorin-3F
2	9606.ENSP00000308461	0.967	Rho-related GTP-binding protein Rho6
3	9606.ENSP00000416523	0.963	Semaphorin-4D
4	9606.ENSP00000350547	0.953	Semaphorin-4F
5	9606.ENSP00000246792	0.935	Ras-related protein R-Ras
6	9606.ENSP00000265371	0.931	Neuropilin-1
7	9606.ENSP00000357909	0.931	Semaphorin-6C
8	9606.ENSP00000371936	0.929	Semaphorin-5A
9	9606.ENSP00000324857	0.927	Semaphorin-6D
10	9606.ENSP00000265362	0.915	Semaphorin-3A
11	9606.ENSP00000484146	0.912	Semaphorin-3B
12	9606.ENSP00000304283	0.903	Ras-related C3 botulinum toxin substrate 3
13	9606.ENSP00000249071	0.896	Ras-related C3 botulinum toxin substrate 2
14	9606.ENSP00000317272	0.896	Hepatocyte growth factor receptor
15	9606.ENSP00000231721	0.892	Semaphorin-3G
16	9606.ENSP00000261918	0.892	Semaphorin-7A
17	9606.ENSP00000265361	0.889	Semaphorin-3C
18	9606.ENSP00000284136	0.886	Semaphorin-3D
19	9606.ENSP00000303212	0.886	Semaphorin-3E
20	9606.ENSP00000380942	0.862	Rho guanine nucleotide exchange factor 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017154	1.000	semaphorin receptor activity
GO:0098631	0.995	cell adhesion mediator activity
GO:0098632	0.883	cell-cell adhesion mediator activity
GO:0019904	0.841	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0023052	0.970	signaling
GO:0007154	0.968	cell communication
GO:0051716	0.948	cellular response to stimulus
GO:0040012	0.925	regulation of locomotion
GO:0007165	0.917	signal transduction
GO:0048519	0.900	negative regulation of biological process
GO:0051128	0.898	regulation of cellular component organization
GO:0030334	0.854	regulation of cell migration
GO:0007166	0.834	cell surface receptor signaling pathway
GO:0048523	0.823	negative regulation of cellular process
GO:0120035	0.819	regulation of plasma membrane bounded cell projection organization
GO:0007155	0.774	cell adhesion
GO:0071526	0.757	semaphorin-plexin signaling pathway
GO:0048518	0.711	positive regulation of biological process
GO:0030336	0.600	negative regulation of cell migration
GO:0048522	0.591	positive regulation of cellular process
GO:0048856	0.587	anatomical structure development
GO:0032501	0.530	multicellular organismal process
GO:0065009	0.474	regulation of molecular function
GO:0006935	0.450	chemotaxis
GO:0007275	0.400	multicellular organism development
GO:0048583	0.395	regulation of response to stimulus
GO:0050790	0.380	regulation of catalytic activity
GO:0048731	0.374	system development
GO:0030155	0.336	regulation of cell adhesion
GO:0019222	0.331	regulation of metabolic process
GO:0071840	0.317	cellular component organization or biogenesis
GO:0016043	0.314	cellular component organization
GO:0009653	0.304	anatomical structure morphogenesis
GO:0051130	0.301	positive regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0009986	0.830	cell surface
GO:0043226	0.706	organelle
GO:0043227	0.697	membrane-bounded organelle
GO:0005622	0.665	intracellular anatomical structure
GO:0043229	0.650	intracellular organelle
GO:0005737	0.376	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]