StarFunc result for job id Q9ULL5

User Input

>input (2036 residues)
MDRNYPSAGFGDPLGAGAGWSYERSAKASLVYGSSRTSHPETDILHRQAYAAPHPLQSYA
TNHHPAGLSGLFDTGLHHAGSAGPDASVMNLISALESRGPQPGPSASSLLSQFRSPSWQT
AMHTPGPTELFISGALPGSSTFPSSSALSAYQHPASFGSRPFPVPSSLSLQDPPFSPPAN
GLLSPHDVLHLKPSQAPTVPSSLGFERLAGGGVLGPAGLGPAQTPPYRPGPPDPPPPPRH
LPTQFNLLASSSAAAAAAEQSSPQLYNFSGAAPGPPPPERALPRQDTVIKHYQRPASAQP
PPPPPPAHALQHYLSCGGSYPSMGHRANLACSPLGGGEPSPGAGEPSKAGPSGATAGASG
RATGPEAAGGGGAGGGGGGYRPIIQSPGYKTGKGGYGAAAGGATRPPPPRSTATPKCQSL
GGPAAAYATGKASGAGGAGGQAYSPGQPQGLLGPQAYGQGFGGGQAQDLSKAPSYSGGPP
QPPSGPPPPGLATCQSYSPDQLQGQLYGVQGEPYPGPAAHSQGLPTASPSLSYSTGHSPA
LSGHGGGWGPSSLGGGGEASPSHIIRPLQSPPATGRPPGVGSPGAPGKYLSSVLASAPFL
APPGAGSYAAGAGGYKGKGDGSELLAGPGGPPAERTEDEEFLIQHLLQAPSPPRTSGADG
LVGEDGAADASKGLGGSGGAGGPPGTPYELAKEDPQRYHLQSVIRTSASLDEGATAALEL
GLGRLKEKKKGPERGGETPEGLATSVVHYGAGAKELGAFLQKSPPPPPPTAQSTQPTPHG
LLLEAGGPDLPLVLPPPPPQLLPSVLSHAPSPSPSASKVGVHLLEPATRDGAPQPPPPPP
PPPPPMPLQLEAHLRSHGLEPAAPSPRLRPEESLDPPGAMQELLGALEPLPPAPGDTGVG
PPNSEGKDPAGAYRSPSPQGTKAPRFVPLTSICFPDSLLQDEERSFFPTMEEMFGGGAAD
DYGKAGPPEDEGDPKAGAGPPPGPPAYDPYGPYCPGRASGAGPETPGLGLDPNKPPELPS
TVNAEPLGLIQSGPHQAAPPPPPPPPPPPAPASEPKGGLTSPIFCSTKPKKLLKTSSFHL
LRRRDPPFQTPKKLYAQEYEFEADEDKADVPADIRLNPRRLPDLVSSCRSRPALSPLGDI
DFCPPNPGPDGPRRRGRKPTKAKRDGPPRPRGRPRIRPLEVPTTAGPASASTPTDGAKKP
RGRGRGRGRKAEEAGGTRLEPLKPLKIKLSVPKAGEGLGTSSGDAISGTDHNSLDSSLTR
EKIEAKIKEVEEKQPEMKSGFMASFLDFLKSGKRHPPLYQAGLTPPLSPPKSVPPSVPAR
GLQPQPPATPAVPHPPPSGAFGLGGALEAAESEGLGLGCPSPCKRLDEELKRNLETLPSF
SSDEEDSVAKNRDLQESISSAISALDDPPLAGPKDTSTPDGPPLAPAAAVPGPPPLPGLP
SANSNGTPEPPLLEEKPPPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPP
LPPPPPPAMPSPPPPPPPAAAPLAAPPEEPAAPSPEDPELPDTRPLHLAKKQETAAVCGE
TDEEAGESGGEGIFRERDEFVIRAEDIPSLKLALQTGREPPPIWRVQKALLQKFTPEIKD
GQRQFCATSNYLGYFGDAKNRYQRLYVKFLENVNKKDYVRVCARKPWHRPPVPVRRSGQA
KNPVSAGGSSAPPPKAPAPPPKPETPEKTTSEKPPEQTPETAMPEPPAPEKPSLLRPVEK
EKEKEKVTRGERPLRGERATSGRQTRPERSLATGQPATSRLPKARPTKVKAEPPPKKRKK
WLKEAGGNATAGGGPPGSSSDSESSPGAPSEDERAVPGRLLKTRAMREMYRSYVEMLVST
ALDPDMIQALEDTHDELYLPPMRKIDGLLNEHKKKVLKRLSLSPALQDALHTFPQLQVEQ
SGEGSPEEGAVRLRPAGEPYNRKTLSKLKRSVVRAQEFKVELEKSGYYTLYHSLHHYKYH
TFLRCRDQTLAIEGGAEDLGQEEVVQQCMRNQPWLEQLFDSFSDLLAQAQAHSRCG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IQT4	0.028	0.027	3.764E-3	2133	0.119	0.113	Q8IQT4.pdb.gz	Q8IQT4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Nirvana PE=1 SV=1
2	AFDB:Q12888	0.042	0.043	4.898E-3	1972	0.143	0.148	Q12888.pdb.gz	TP53B_HUMAN TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2
3	AFDB:A0A0R4IJ26	0.026	0.028	5.443E-3	1760	0.132	0.152	A0A0R4IJ26.pdb.gz
4	AFDB:F4JP43	0.033	0.033	2.788E-2	2037	0.141	0.141	F4JP43.pdb.gz	F4JP43_ARATH G2484-1 protein OS=Arabidopsis thaliana OX=3702 GN=G2484-1 PE=1 SV=1
5	AFDB:Q9VRM6	0.031	0.032	2.939E-2	1929	0.125	0.132	Q9VRM6.pdb.gz	Q9VRM6_DROME Lethal (3) persistent salivary gland 2 OS=Drosophila melanogaster OX=7227 GN=l(3)psg2 PE=4 SV=2
6	AFDB:A1Z9K8	0.030	0.031	3.098E-2	1871	0.120	0.131	A1Z9K8.pdb.gz	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
7	AFDB:Q7Z5J4	0.028	0.029	3.825E-2	1906	0.167	0.179	Q7Z5J4.pdb.gz	RAI1_HUMAN Retinoic acid-induced protein 1 OS=Homo sapiens OX=9606 GN=RAI1 PE=1 SV=2
8	AFDB:F1Q6T6	0.027	0.024	4.032E-2	2357	0.139	0.120	F1Q6T6.pdb.gz
9	AFDB:Q3LHL9	0.038	0.044	4.250E-2	1658	0.117	0.144	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
10	AFDB:F1M842	0.036	0.036	4.978E-2	1972	0.128	0.132	F1M842.pdb.gz	F1M842_RAT Tumor protein p53 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tp53bp1 PE=1 SV=3
11	PDB:2qimA	0.018	0.148	4.622E-1	157	0.003	0.045	2qimA.pdb.gz	Lupinus luteus pathogenesis-related protein as a reservoir for cytokinin.
12	PDB:1ek8A	0.033	0.208	9.666E-1	185	0.010	0.114	1ek8A.pdb.gz	Crystal structure of the ribosome recycling factor from Escherichia coli.
13	PDB:7p4iA	0.032	0.096	9.666E-1	428	0.012	0.058	7p4iA.pdb.gz
14	PDB:6r1gA	0.016	0.166	1.326	148	0.004	0.061	6r1gA.pdb.gz	Structural analysis of Borrelia burgdorferi periplasmic lipoprotein BB0365 involved in Lyme disease infection.
15	PDB:3kffA	0.023	0.136	1.398	152	0.004	0.059	3kffA.pdb.gz	High resolution X-ray structures of mouse major urinary protein nasal isoform in complex with pheromones.
16	PDB:7wzsA	0.023	0.088	2.021	434	0.008	0.039	7wzsA.pdb.gz
17	PDB:5ltwG	0.020	0.152	2.246	118	0.004	0.076	5ltwG.pdb.gz
18	PDB:3pdfA	0.017	0.064	2.496	351	0.003	0.020	3pdfA.pdb.gz	Discovery of novel cyanamide-based inhibitors of cathepsin C.
19	PDB:5m1iA	0.018	0.056	2.496	539	0.004	0.015	5m1iA.pdb.gz	Structural Snapshots for Mechanism-Based Inactivation of a Glycoside Hydrolase by Cyclopropyl Carbasugars.
20	PDB:7lsyH	0.022	0.123	2.631	223	0.012	0.108	7lsyH.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q54VJ6	8.00e-06	53.1	462	0.013	0.058	Q54VJ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280299 PE=4 SV=1
2	A0A0A6YYJ5	0.26	38.9	1668	0.024	0.029	A0A0A6YYJ5_HUMAN Microtubule actin crosslinking factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=2
3	Q9VT65	0.51	37.7	925	0.021	0.046	CANB_DROME Calpain-B OS=Drosophila melanogaster OX=7227 GN=CalpB PE=1 SV=2
4	Q9QYX7	3.4	35.4	5068	0.018	0.007	PCLO_MOUSE Protein piccolo OS=Mus musculus OX=10090 GN=Pclo PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13926 DUF4211	3.2e-09	48.4	Domain of unknown function (DUF4211)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000394510

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353769	0.895	Splicing factor, arginine/serine-rich 19
2	9606.ENSP00000246794	0.848	Transmembrane gamma-carboxyglutamic acid protein 2
3	9606.ENSP00000385118	0.798	Protein Largen
4	9606.ENSP00000482218	0.738	Bcl-2-like protein 12
5	9606.ENSP00000430497	0.728	Zinc finger homeobox protein 4
6	9606.ENSP00000278200	0.724	Mitochondrial inner membrane protease subunit 1
7	9606.ENSP00000350833	0.719	Metallophosphoesterase MPPED2
8	9606.ENSP00000054950	0.715	Reticulocalbin-1
9	9606.ENSP00000246891	0.693	Alpha-S1-casein
10	9606.ENSP00000470034	0.663	Nitric oxide synthase-interacting protein
11	9606.ENSP00000447679	0.658	Putative transmembrane protein INAFM1
12	9606.ENSP00000309714	0.647	SH3 and PX domain-containing protein 2B
13	9606.ENSP00000368872	0.642	Protein inscuteable homolog
14	9606.ENSP00000373298	0.587	Acetylcholinesterase collagenic tail peptide
15	9606.ENSP00000294304	0.572	Low-density lipoprotein receptor-related protein 5
16	9606.ENSP00000378028	0.565	E3 ubiquitin-protein ligase RNF14
17	9606.ENSP00000482378	0.555	Low-density lipoprotein receptor-related protein 5-like protein
18	9606.ENSP00000358777	0.552	V-type proton ATPase subunit S1
19	9606.ENSP00000216139	0.528	Acrosin
20	9606.ENSP00000301698	0.519	Proline-rich protein 25

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.955	regulation of cellular process
GO:0019222	0.808	regulation of metabolic process
GO:0060255	0.760	regulation of macromolecule metabolic process
GO:0080090	0.659	regulation of primary metabolic process
GO:0051171	0.659	regulation of nitrogen compound metabolic process
GO:0009889	0.654	regulation of biosynthetic process
GO:0031323	0.643	regulation of cellular metabolic process
GO:0010468	0.635	regulation of gene expression
GO:0031326	0.620	regulation of cellular biosynthetic process
GO:0010556	0.619	regulation of macromolecule biosynthetic process
GO:0006355	0.598	regulation of DNA-templated transcription
GO:0048518	0.501	positive regulation of biological process
GO:0009987	0.458	cellular process
GO:0009893	0.426	positive regulation of metabolic process
GO:0048522	0.330	positive regulation of cellular process
GO:0010604	0.320	positive regulation of macromolecule metabolic process
GO:0051173	0.315	positive regulation of nitrogen compound metabolic process
GO:0008152	0.302	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.985	nucleoplasm
GO:0043232	0.776	intracellular non-membrane-bounded organelle
GO:0005737	0.765	cytoplasm
GO:0032991	0.453	protein-containing complex
GO:1902494	0.428	catalytic complex
GO:0070603	0.419	SWI/SNF superfamily-type complex
GO:0016020	0.410	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]