StarFunc result for job id Q9ULL8

User Input

>input (1493 residues)
MENRPGSFQYVPVQLQGGAPWGFTLKGGLEHCEPLTVSKIEDGGKAALSQKMRTGDELVN
INGTPLYGSRQEALILIKGSFRILKLIVRRRNAPVSRPHSWHVAKLLEGCPEAATTMHFP
SEAFSLSWHSGCNTSDVCVQWCPLSRHCSTEKSSSIGSMESLEQPGQATYESHLLPIDQN
MYPNQRDSAYSSFSASSNASDCALSLRPEEPASTDCIMQGPGPTKAPSGRPNVAETSGGS
RRTNGGHLTPSSQMSSRPQEGYQSGPAKAVRGPPQPPVRRDSLQASRAQLLNGEQRRASE
PVVPLPQKEKLSLEPVLPARNPNRFCCLSGHDQVTSEGHQNCEFSQPPESSQQGSEHLLM
QASTKAVGSPKACDRASSVDSNPLNEASAELAKASFGRPPHLIGPTGHRHSAPEQLLASH
LQHVHLDTRGSKGMELPPVQDGHQWTLSPLHSSHKGKKSPCPPTGGTHDQSSKERKTRQV
DDRSLVLGHQSQSSPPHGEADGHPSEKGFLDPNRTSRAASELANQQPSASGSLVQQATDC
SSTTKAASGTEAGEEGDSEPKECSRMGGRRSGGTRGRSIQNRRKSERFATNLRNEIQRRK
AQLQKSKGPLSQLCDTKEPVEETQEPPESPPLTASNTSLLSSCKKPPSPRDKLFNKSMML
RARSSECLSQAPESHESRTGLEGRISPGQRPGQSSLGLNTWWKAPDPSSSDPEKAHAHCG
VRGGHWRWSPEHNSQPLVAAAMEGPSNPGDNKELKASTAQAGEDAILLPFADRRKFFEES
SKSLSTSHLPGLTTHSNKTFTQRPKPIDQNFQPMSSSCRELRRHPMDQSYHSADQPYHAT
DQSYHSMSPLQSETPTYSECFASKGLENSMCCKPLHCGDFDYHRTCSYSCSVQGALVHDP
CIYCSGEICPALLKRNMMPNCYNCRCHHHQCIRCSVCYHNPQHSALEDSSLAPGNTWKPR
KLTVQEFPGDKWNPITGNRKTSQSGREMAHSKTSFSWATPFHPCLENPALDLSSYRAISS
LDLLGDFKHALKKSEETSVYEEGSSLASMPHPLRSRAFSESHISLAPQSTRAWGQHRREL
FSKGDETQSDLLGARKKAFPPPRPPPPNWEKYRLFRAAQQQKQQQQQQKQQEEEEEEEEE
EEEEEEEEEEEAEEEEEELPPQYFSSETSGSCALNPEEVLEQPQPLSFGHLEGSRQGSQS
VPAEQESFALHSSDFLPPIRGHLGSQPEQAQPPCYYGIGGLWRTSGQEATESAKQEFQHF
SPPSGAPGIPTSYSAYYNISVAKAELLNKLKDQPEMAEIGLGEEEVDHELAQKKIQLIES
ISRKLSVLREAQRGLLEDINANSALGEEVEANLKAVCKSNEFEKYHLFVGDLDKVVNLLL
SLSGRLARVENALNSIDSEANQEKLVLIEKKQQLTGQLADAKELKEHVDRREKLVFGMVS
RYLPQDQLQDYQHFVKMKSALIIEQRELEEKIKLGEEQLKCLRESLLLGPSNF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q1W617	0.174	0.175	0.000	1475	0.778	0.787	Q1W617.pdb.gz	SHRM4_MOUSE Protein Shroom4 OS=Mus musculus OX=10090 GN=Shroom4 PE=1 SV=1
2	AFDB:Q9ULL8	1.000	1.000	0.000	1493	1.000	1.000	Q9ULL8.pdb.gz	SHRM4_HUMAN Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4 PE=1 SV=3
3	AFDB:A2ALU4	0.141	0.141	1.080E-41	1481	0.281	0.283	A2ALU4.pdb.gz	SHRM2_MOUSE Protein Shroom2 OS=Mus musculus OX=10090 GN=Shroom2 PE=1 SV=1
4	AFDB:Q13796	0.138	0.129	2.412E-39	1616	0.263	0.243	Q13796.pdb.gz	SHRM2_HUMAN Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1
5	AFDB:Q9QXN0	0.138	0.106	1.687E-32	1986	0.301	0.227	Q9QXN0.pdb.gz	SHRM3_MOUSE Protein Shroom3 OS=Mus musculus OX=10090 GN=Shroom3 PE=1 SV=2
6	AFDB:Q09JY9	0.148	0.130	1.788E-32	1726	0.255	0.221	Q09JY9.pdb.gz	SHRM2_XENTR Protein Shroom2 OS=Xenopus tropicalis OX=8364 GN=shroom2 PE=2 SV=1
7	AFDB:A0A0R4IS11	0.069	0.067	7.996E-13	1565	0.176	0.168	A0A0R4IS11.pdb.gz
8	AFDB:A1Z9P3	0.121	0.115	5.142E-12	1576	0.174	0.165	A1Z9P3.pdb.gz	SHRM_DROME Protein Shroom OS=Drosophila melanogaster OX=7227 GN=Shrm PE=1 SV=2
9	AFDB:D4A702	0.065	0.075	2.446E-9	1262	0.142	0.168	D4A702.pdb.gz	SYNP2_RAT Synaptopodin-2 OS=Rattus norvegicus OX=10116 GN=Synpo2 PE=1 SV=2
10	AFDB:Q8BWB1	0.062	0.093	8.792E-9	975	0.108	0.165	Q8BWB1.pdb.gz	SYP2L_MOUSE Synaptopodin 2-like protein OS=Mus musculus OX=10090 GN=Synpo2l PE=1 SV=1
11	PDB:6t36A	0.055	0.814	1.608E-6	93	0.019	0.312	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
12	PDB:7pc3A	0.057	0.205	3.232E-6	405	0.016	0.059	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:7p73A	0.055	0.193	7.296E-6	420	0.016	0.057	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
14	PDB:5n7dA	0.054	0.181	8.687E-6	423	0.017	0.061	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
15	PDB:7p70A	0.056	0.196	1.231E-5	407	0.017	0.061	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
16	PDB:2xkxA	0.059	0.119	1.850E-5	721	0.017	0.035	2xkxA.pdb.gz
17	PDB:7qqmA	0.058	0.202	2.078E-5	413	0.012	0.044	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:7qqnC	0.052	0.175	5.586E-5	414	0.016	0.058	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:7pc5A	0.055	0.195	1.190E-4	405	0.019	0.069	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7pe9I	0.050	0.215	2.534E-4	317	0.011	0.050	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q1W617	0.0	2201	1475	0.778	0.788	SHRM4_MOUSE Protein Shroom4 OS=Mus musculus OX=10090 GN=Shroom4 PE=1 SV=1
2	Q9ULL8	0.0	3068	1493	1.000	1.000	SHRM4_HUMAN Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4 PE=1 SV=3
3	A2ALU4	9.14e-72	267	1481	0.093	0.094	SHRM2_MOUSE Protein Shroom2 OS=Mus musculus OX=10090 GN=Shroom2 PE=1 SV=1
4	Q13796	2.34e-69	260	1616	0.092	0.085	SHRM2_HUMAN Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1
5	Q9QXN0	2.09e-65	248	1986	0.086	0.064	SHRM3_MOUSE Protein Shroom3 OS=Mus musculus OX=10090 GN=Shroom3 PE=1 SV=2
6	Q09JY9	3.11e-65	247	1726	0.084	0.072	SHRM2_XENTR Protein Shroom2 OS=Xenopus tropicalis OX=8364 GN=shroom2 PE=2 SV=1
7	Q27IV2	7.12e-65	246	1788	0.085	0.071	SHRM3_XENLA Protein Shroom3 OS=Xenopus laevis OX=8355 GN=shroom3 PE=2 SV=1
8	K7X477	7.65e-34	145	1600	0.062	0.058	K7X477_DANRE Protein Shroom3 OS=Danio rerio OX=7955 GN=shroom3v2 PE=2 SV=1
9	A1Z9P3	4.86e-18	93.6	1576	0.043	0.041	SHRM_DROME Protein Shroom OS=Drosophila melanogaster OX=7227 GN=Shrm PE=1 SV=2
10	Q91YE8	2.41e-10	68.2	1087	0.024	0.033	SYNP2_MOUSE Synaptopodin-2 OS=Mus musculus OX=10090 GN=Synpo2 PE=1 SV=2
11	A0A140LH61	9.13e-10	66.2	1151	0.028	0.036	A0A140LH61_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=1
12	Q9UMS6	7.57e-09	63.2	1093	0.022	0.030	SYNP2_HUMAN Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2
13	Q5SX79	1.39e-08	62.0	823	0.041	0.074	SHRM1_MOUSE Protein Shroom1 OS=Mus musculus OX=10090 GN=Shroom1 PE=1 SV=2
14	D4A702	1.60e-08	62.0	1262	0.022	0.026	SYNP2_RAT Synaptopodin-2 OS=Rattus norvegicus OX=10116 GN=Synpo2 PE=1 SV=2
15	Q96HC4	1.96e-08	61.2	596	0.023	0.059	PDLI5_HUMAN PDZ and LIM domain protein 5 OS=Homo sapiens OX=9606 GN=PDLIM5 PE=1 SV=5
16	Q8BWB1	2.41e-08	61.2	975	0.024	0.037	SYP2L_MOUSE Synaptopodin 2-like protein OS=Mus musculus OX=10090 GN=Synpo2l PE=1 SV=1
17	B7Z8X5	2.75e-08	60.5	483	0.025	0.079	B7Z8X5_HUMAN cDNA FLJ61541, highly similar to Homo sapiens PDZ and LIM domain 5 (PDLIM5), transcript variant 2, mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
18	U3JAM7	4.06e-08	60.8	1184	0.025	0.031	U3JAM7_DANRE Synaptopodin 2-like b OS=Danio rerio OX=7955 GN=synpo2lb PE=4 SV=1
19	F1RCC9	7.65e-08	59.7	1179	0.024	0.031	F1RCC9_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=2
20	Q8CI51	1.64e-07	58.2	591	0.022	0.056	PDLI5_MOUSE PDZ and LIM domain protein 5 OS=Mus musculus OX=10090 GN=Pdlim5 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08687 ASD2	1.3e-93	325.4	Apx/Shroom domain ASD2
2	PF05432 BSP_II	22	16.2	Bone sialoprotein II (BSP-II)
3	PF09747 CCD97-like_C	16	17.1	Coiled-coil domain containing protein 97-like, C-terminal
4	PF14851 FAM176	8.5e+02	11.1	FAM176 family
5	PF09538 FYDLN_acid	7.4e+02	12.2	Protein of unknown function (FYDLN_acid)
6	PF17800 NPL	4.5e+02	12.9	Nucleoplasmin-like domain
7	PF00595 PDZ	0.018	26.7	PDZ domain
8	PF17820 PDZ_6	67	14.8	PDZ domain
9	PF03286 Pox_Ag35	2.7e+02	12.7	Pox virus Ag35 surface protein
10	PF08615 RNase_H2_suC	1.2e+02	14.3	Ribonuclease H2 non-catalytic subunit (Ylr154p-like)
11	PF18004 RPN2_C	4.8e+02	12.0	26S proteasome regulatory subunit RPN2 C-terminal domain
12	PF11711 Tim54	67	13.7	Inner membrane protein import complex subunit Tim54

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365188

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000470298	0.720	Myosin-14
2	9606.ENSP00000262873	0.643	Myosin-7B
3	9606.ENSP00000216714	0.640	DNA-(apurinic or apyrimidinic site) lyase
4	9606.ENSP00000230449	0.520	Exocyst complex component 2
5	9606.ENSP00000450337	0.508	Liprin-alpha-2
6	9606.ENSP00000355014	0.506	E3 ubiquitin-protein ligase Praja-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051015	0.999	actin filament binding
GO:0017022	0.993	myosin binding
GO:0045159	0.981	myosin II binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.913	anatomical structure development
GO:0009987	0.813	cellular process
GO:0032501	0.801	multicellular organismal process
GO:0007275	0.616	multicellular organism development
GO:0060322	0.540	head development
GO:0048731	0.533	system development
GO:0048513	0.511	animal organ development
GO:0065007	0.499	biological regulation
GO:0050877	0.448	nervous system process
GO:0007417	0.405	central nervous system development
GO:0050789	0.353	regulation of biological process
GO:0050794	0.334	regulation of cellular process
GO:0007420	0.301	brain development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0015629	0.996	actin cytoskeleton
GO:0005654	0.995	nucleoplasm
GO:0005737	0.980	cytoplasm
GO:0099080	0.821	supramolecular complex
GO:0030054	0.733	cell junction
GO:0099512	0.723	supramolecular fiber
GO:0070161	0.465	anchoring junction
GO:0098562	0.405	cytoplasmic side of membrane
GO:0005829	0.403	cytosol
GO:0099513	0.401	polymeric cytoskeletal fiber
GO:0009898	0.397	cytoplasmic side of plasma membrane
GO:0030055	0.384	cell-substrate junction
GO:0005884	0.369	actin filament
GO:0005925	0.308	focal adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]