StarFunc result for job id Q9ULM0

User Input

>input (1364 residues)
MAELKVEAPASVDWQKRCLTLETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENA
ETQVGVMEEKVKLSNLKNVDSEGSLHRKYQELLKAIKGKDELISQLEAQLEKQKQMRAEE
AKTVQEKAAKIKEWVTLKLAKLEMENQHLKSHNQRLVEQVGSLQDALEAIQIAPSRKLLV
PPYGAAEQDSVPSEPGIQPMGQDSGSQAQGLKAAVLAPSPGALQSKDSVSEAASPLEDSS
SSTVHSGETVEAKPLQPHLGRESPPHQPCMKLLTFRCSSASWGEGLVTAQRGMLPGTKTS
AREGGPGSSLTLPKVRAPGTPRDSIQLAKRHHSQPQVGHGHFGRVVNIETEAFSALHPSG
LPELESRARSREEPEKMEMEEPPPAGKNEERESPKALGAELEEVELGNKPPTPPLHQFSS
WESRIYAVATSGMRLSDMSPRSNTACCASSPPALVSPGSFSGLVYKNVTVPVYTALKGRA
TQISNMPFMDESSGSDDDCSSQASFRISVPSSESRKTSGLGSPRAIKRGVSMSSLSSEGD
YAIPPDACSLDSDYSEPEHKLQRTSSYSTDGLGLGGESLEKSGYLLKMGSQVKTWKRRWF
VLRQGQIMYYKSPSDVIRKPQGQVDLNSRCQIVRGEGSQTFQLISEKKTYYLTADSPSLL
EEWIRVLQSLLKVQATGPPALLRGGTKPTVKGWLTKVKHGHSKVVWCALVGKIFYYYRSH
EDKRPLGCLPVRDAHIEEVDRSCDSDEDYEAGGTRRLLSSHCTLVIHPTEHSPTYLLIGT
KHEKDTWLYHLTVAAGGSSAKVGTAYEQLIGKLMDGEGDPDSPLWRHPMLCYSKDGLYAS
LTTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQ
LMKQTSCRPPQKYSLMQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRSETGQYATYC
QRAVERTLRTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFTNGTYHVVGFDGSSTVD
EFLQRLNQEIGMRKPSHSGFALFTDDPSGRDLEHCLQGSVKICDAISKWEQAMKELHPGK
SEGGTRVVKLMYKNRLYFRSQVKGETDRERLLLASQTSREIVAGRFPINKELALEMAALM
AQVEYGDLEKPALPGPGGTSPAKAQHLLQQVLDRFHPRRYRHGAPAEQLRHLADMLTTKW
ATLQGCSPPECIRIYLTVARKWPFFGAKLFAAQPAQLSSKENALVWIAVNEDGVSILDHN
TMQVHITYPYSSVTTFGGCRDDFMLVIRSIPDKSSGKSHIEKLIFRMAAPKIAEATFIMA
SYMNHCTTTVNPPTNPPGACQLWELDGRQFFSSVSCATKGPTLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q00IB7	0.453	0.432	0.000	1433	0.582	0.554	Q00IB7.pdb.gz	PKHH1_DANRE Pleckstrin homology domain-containing family H member 1 OS=Danio rerio OX=7955 GN=plekhh1 PE=2 SV=1
2	AFDB:Q8C115	0.559	0.514	0.000	1491	0.521	0.477	Q8C115.pdb.gz	PKHH2_MOUSE Pleckstrin homology domain-containing family H member 2 OS=Mus musculus OX=10090 GN=Plekhh2 PE=1 SV=3
3	AFDB:Q8IVE3	0.511	0.469	0.000	1493	0.531	0.485	Q8IVE3.pdb.gz	PKHH2_HUMAN Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens OX=9606 GN=PLEKHH2 PE=1 SV=2
4	AFDB:Q8WZ64	0.087	0.076	4.606E-14	1704	0.128	0.103	Q8WZ64.pdb.gz	ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARAP2 PE=1 SV=3
5	PDB:4rm8A	0.178	0.556	2.891E-10	368	0.043	0.158	4rm8A.pdb.gz
6	PDB:3ljuX	0.066	0.226	2.861E-8	373	0.021	0.075	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
7	AFDB:Q9VDE9	0.134	0.137	3.667E-6	1330	0.133	0.136	Q9VDE9.pdb.gz	Q9VDE9_DROME FI04035p OS=Drosophila melanogaster OX=7227 GN=RhoGAP93B PE=2 SV=2
8	PDB:6hhgA	0.062	0.208	1.812E-5	386	0.043	0.150	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
9	AFDB:Q5T5U3	0.071	0.050	2.826E-5	1958	0.082	0.057	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
10	PDB:6u3eA	0.066	0.222	3.162E-5	397	0.023	0.078	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
11	PDB:6s9wA	0.058	0.182	3.470E-5	411	0.031	0.102	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
12	PDB:6bbpA	0.062	0.161	6.961E-5	520	0.023	0.060	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
13	AFDB:A0A1D8PRW9	0.069	0.080	7.489E-5	1172	0.070	0.082	A0A1D8PRW9.pdb.gz	A0A1D8PRW9_CANAL Boi2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BOI2 PE=4 SV=1
14	PDB:7c3mA	0.060	0.133	9.196E-5	577	0.021	0.050	7c3mA.pdb.gz
15	AFDB:P34288	0.065	0.057	2.622E-4	1605	0.117	0.099	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
16	PDB:4mk0A	0.059	0.125	4.667E-4	631	0.015	0.032	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
17	AFDB:A0A0R4IEP9	0.049	0.050	9.616E-4	1332	0.098	0.101	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
18	AFDB:A0A0G2K7W4	0.053	0.053	1.007E-3	1348	0.103	0.105	A0A0G2K7W4.pdb.gz	A0A0G2K7W4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=2
19	PDB:6i7sG	0.085	0.116	1.027E-3	863	0.059	0.093	6i7sG.pdb.gz	The crystal structure of human microsomal triglyceride transfer protein.
20	PDB:6r9tA	0.119	0.077	1.127E-3	2185	0.026	0.016	6r9tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q00IB7	0.0	1329	1433	0.496	0.472	PKHH1_DANRE Pleckstrin homology domain-containing family H member 1 OS=Danio rerio OX=7955 GN=plekhh1 PE=2 SV=1
2	Q8C115	0.0	1111	1491	0.441	0.403	PKHH2_MOUSE Pleckstrin homology domain-containing family H member 2 OS=Mus musculus OX=10090 GN=Plekhh2 PE=1 SV=3
3	Q8IVE3	0.0	1178	1493	0.443	0.405	PKHH2_HUMAN Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens OX=9606 GN=PLEKHH2 PE=1 SV=2
4	G5ED24	2.27e-111	380	1099	0.210	0.261	G5ED24_CAEEL MAX-1A OS=Caenorhabditis elegans OX=6239 GN=max-1 PE=2 SV=1
5	I3ITL5	4.46e-26	119	2041	0.124	0.083	I3ITL5_DANRE Myosin X,-like 1 OS=Danio rerio OX=7955 GN=myo10l1 PE=3 SV=1
6	P79114	8.32e-23	108	2052	0.120	0.079	MYO10_BOVIN Unconventional myosin-X OS=Bos taurus OX=9913 GN=MYO10 PE=1 SV=1
7	F8VQB6	6.77e-22	105	2062	0.120	0.079	MYO10_MOUSE Unconventional myosin-X OS=Mus musculus OX=10090 GN=Myo10 PE=1 SV=1
8	E9PEW5	2.03e-21	104	1397	0.121	0.118	E9PEW5_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
9	A0A0A0MQX1	4.97e-21	103	2069	0.120	0.079	A0A0A0MQX1_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
10	Q9HD67	5.18e-21	103	2058	0.120	0.079	MYO10_HUMAN Unconventional myosin-X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=3
11	Q7Y1U0	1.46e-18	94.7	1209	0.073	0.083	Q7Y1U0_GOSHI Kinesin-like calmodulin binding protein OS=Gossypium hirsutum OX=3635 GN=LOC107939602 PE=2 SV=1
12	Q9FHN8	3.93e-16	87.0	1260	0.071	0.077	KN14E_ARATH Kinesin-like protein KIN-14E OS=Arabidopsis thaliana OX=3702 GN=KIN14E PE=1 SV=1
13	F4JXM5	5.17e-16	86.7	1266	0.071	0.077	F4JXM5_ARATH Kinesin-like calmodulin-binding protein (ZWICHEL) OS=Arabidopsis thaliana OX=3702 GN=ZWI PE=1 SV=1
14	Q9DGG9	9.00e-16	85.9	2179	0.073	0.046	Q9DGG9_DANRE Myosin VIIA OS=Danio rerio OX=7955 GN=myo7A PE=2 SV=1
15	Q13402	2.61e-15	84.3	2215	0.077	0.047	MYO7A_HUMAN Unconventional myosin-VIIa OS=Homo sapiens OX=9606 GN=MYO7A PE=1 SV=2
16	A0A8J8XYU9	5.97e-15	83.2	2215	0.058	0.036	A0A8J8XYU9_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
17	P97479	7.25e-15	82.8	2215	0.058	0.036	MYO7A_MOUSE Unconventional myosin-VIIa OS=Mus musculus OX=10090 GN=Myo7a PE=1 SV=2
18	A0A8I5ZWB0	7.52e-15	82.8	2238	0.056	0.034	A0A8I5ZWB0_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
19	Q8CJE3	8.78e-15	82.8	2177	0.056	0.035	Q8CJE3_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=2 SV=1
20	Q86AC8	2.24e-14	81.3	3446	0.051	0.020	MYOG_DICDI Myosin-G heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoG PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09380 FERM_C	5.5e+02	12.4	FERM C-terminal PH-like domain
2	PF00373 FERM_M	1.7e-08	46.2	FERM central domain
3	PF02183 HALZ	4.2e+02	12.6	Homeobox associated leucine zipper
4	PF00784 MyTH4	2.5e-27	106.7	MyTH4 domain
5	PF00169 PH	1.7e-21	88.0	PH domain
6	PF15413 PH_11	0.00088	31.1	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330278

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000226091	0.578	Ephrin-B3
2	9606.ENSP00000251119	0.541	Zinc finger FYVE domain-containing protein 26
3	9606.ENSP00000381937	0.529	Protein ABHD18
4	9606.ENSP00000378757	0.527	Monocarboxylate transporter 9
5	9606.ENSP00000358320	0.513	DNA-directed RNA polymerase III subunit RPC7-like
6	9606.ENSP00000359594	0.513	Calcium-activated chloride channel regulator 4
7	9606.ENSP00000202816	0.511	ESF1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.687	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.972	cellular process
GO:0065007	0.820	biological regulation
GO:0050789	0.803	regulation of biological process
GO:0050794	0.724	regulation of cellular process
GO:0032502	0.398	developmental process
GO:0032501	0.396	multicellular organismal process
GO:0048856	0.393	anatomical structure development
GO:0007275	0.366	multicellular organism development
GO:0009653	0.310	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0043229	0.997	intracellular organelle
GO:0071944	0.947	cell periphery
GO:0043232	0.895	intracellular non-membrane-bounded organelle
GO:0016020	0.872	membrane
GO:0043227	0.661	membrane-bounded organelle
GO:0070013	0.407	intracellular organelle lumen
GO:0031981	0.403	nuclear lumen
GO:0120025	0.388	plasma membrane bounded cell projection
GO:0005856	0.388	cytoskeleton
GO:0005654	0.375	nucleoplasm
GO:0005829	0.316	cytosol
GO:0005886	0.308	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]