StarFunc result for job id Q9ULM3

User Input

>input (1422 residues)
MSGIKRTIKETDPDYEDVSVALPNKRHKAIENSARDAAVQKIETIIKEQFALEMKNKEHE
IEVIDQRLIEARRMMDKLRACIVANYYASAGLLKVSEGSKTCDTMVFNHPAIKKFLESPS
RSSSPANQRAETPSANHSESDSLSQHNDFLSDKDNNSNMDIEERLSNNMEQRPSRNTGRD
TSRITGSHKTEQRNADLTDETSRLFVKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVRG
SRREPSINHFVKKVWFFLHPSYKPNDLVEVREPPFHLTRRGWGEFPVRVQVHFKDSQNKR
IDIIHNLKLDRTYTGLQTLGAETVVDVELHRHSLGEDCIYPQSSESDISDAPPSLPLTIP
APVKASSPIKQSHEPVPDTSVEKGFPASTEAERHTPFYALPSSLERTPTKMTTSQKVTFC
SHGNSAFQPIASSCKIVPQSQVPNPESPGKSFQPITMSCKIVSGSPISTPSPSPLPRTPT
STPVHVKQGTAGSVINNPYVIMDKQPGQVIGATTPSTGSPTNKISTASQVSQGTGSPVPK
IHGSSFVTSTVKQEDSLFASMPPLCPIGSHPKVQSPKPITGGLGAFTKVIIKQEPGEAPH
VPATGAASQSPLPQYVTVKGGHMIAVSPQKQVITPGEGIAQSAKVQPSKVVGVPVGSALP
STVKQAVAISGGQILVAKASSSVSKAVGPKQVVTQGVAKAIVSGGGGTIVAQPVQTLTKA
QVTAAGPQKSGSQGSVMATLQLPATNLANLANLPPGTKLYLTTNSKNPSGKGKLLLIPQG
AILRATNNANLQSGSAASGGSGAGGGGGGGGGGGSGSGGGGSTGGGGGTAGGGTQSTAGP
GGISQHLTYTSYILKQTPQGTFLVGQPSPQTSGKQLTTGSVVQGTLGVSTSSAQGQQTLK
VISGQKTTLFTQAAHGGQASLMKISDSTLKTVPATSQLSKPGTTMLRVAGGVITTATSPA
VALSANGPAQQSEGMAPVSSSTVSSVTKTSGQQQVCVSQATVGTCKAATPTVVSATSLVP
TPNPISGKATVSGLLKIHSSQSSPQQAVLTIPSQLKPLSVNTSGGVQTILMPVNKVVQSF
STSKPPAILPVAAPTPVVPSSAPAAVAKVKTEPETPGPSCLSQEGQTAVKTEESSELGNY
VIKIDHLETIQQLLTAVVKKIPLITAKSEDASCFSAKSVEQYYGWNIGKRRAAEWQRAMT
MRKVLQEILEKNPRFHHLTPLKTKHIAHWCRCHGYTPPDPESLRNDGDSIEDVLTQIDSE
PECPSSFSSADNLCRKLEDLQQFQKREPENEEEVDILSLSEPVKINIKKEQEEKQEEVKF
YLPPTPGSEFIGDVTQKIGITLQPVALHRNVYASVVEDMILKATEQLVNDILRQALAVGY
QTASHNRIPKEITVSNIHQAICNIPFLDFLTNKHMGILNEDQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3TUF7	0.181	0.183	0.000	1407	0.866	0.876	Q3TUF7.pdb.gz	YETS2_MOUSE YEATS domain-containing protein 2 OS=Mus musculus OX=10090 GN=Yeats2 PE=1 SV=2
2	AFDB:Q9ULM3	1.000	1.000	0.000	1422	1.000	1.000	Q9ULM3.pdb.gz	YETS2_HUMAN YEATS domain-containing protein 2 OS=Homo sapiens OX=9606 GN=YEATS2 PE=1 SV=2
3	PDB:5svan	0.078	0.498	4.517E-8	200	0.021	0.150	5svan.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
4	AFDB:Q9VZT8	0.041	0.040	4.107E-5	1443	0.107	0.105	Q9VZT8.pdb.gz	Q9VZT8_DROME Myomesin and myosin binding protein OS=Drosophila melanogaster OX=7227 GN=MnM PE=4 SV=3
5	AFDB:Q8N3D4	0.045	0.047	2.511E-4	1523	0.130	0.121	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
6	AFDB:Q9GV71	0.038	0.037	4.850E-4	1543	0.101	0.093	Q9GV71.pdb.gz	Q9GV71_DICDI MAP kinase phosphatase OS=Dictyostelium discoideum OX=44689 GN=mkpA PE=4 SV=1
7	AFDB:Q8CGM2	0.042	0.035	2.019E-3	1859	0.136	0.104	Q8CGM2.pdb.gz	RP1L1_MOUSE Retinitis pigmentosa 1-like 1 protein OS=Mus musculus OX=10090 GN=Rp1l1 PE=1 SV=1
8	AFDB:A0A5F8MPU3	0.045	0.032	2.515E-3	2282	0.117	0.073	A0A5F8MPU3.pdb.gz	CTSRT_MOUSE Cation channel sperm-associated targeting subunit tau OS=Mus musculus OX=10090 GN=C2cd6 PE=1 SV=1
9	AFDB:Q99MR9	0.053	0.065	2.657E-3	1089	0.092	0.120	Q99MR9.pdb.gz	PPR3A_MOUSE Protein phosphatase 1 regulatory subunit 3A OS=Mus musculus OX=10090 GN=Ppp1r3a PE=1 SV=2
10	AFDB:P27715	0.038	0.027	3.692E-3	2155	0.092	0.061	P27715.pdb.gz	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
11	AFDB:Q5JRA6	0.051	0.040	5.132E-3	1907	0.117	0.087	Q5JRA6.pdb.gz	TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1
12	PDB:6wskA	0.063	0.236	1.223E-2	287	0.009	0.045	6wskA.pdb.gz
13	PDB:7cunG	0.048	0.069	5.681E-2	895	0.013	0.020	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
14	PDB:3pfqA	0.061	0.139	1.159E-1	523	0.011	0.029	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
15	PDB:3csbA	0.045	0.119	2.239E-1	464	0.006	0.019	3csbA.pdb.gz	A Dominant Conformational Role for Amino Acid Diversity in Minimalist Protein-Protein Interfaces
16	PDB:1ogpA	0.032	0.103	2.946E-1	388	0.007	0.026	1ogpA.pdb.gz	The Crystal Structure of Plant Sulfite Oxidase Provides Insights Into Sulfite Oxidation in Plants and Animals
17	PDB:7kahD	0.027	0.067	3.112E-1	493	0.009	0.026	7kahD.pdb.gz
18	PDB:1qj8A	0.031	0.124	3.473E-1	148	0.011	0.108	1qj8A.pdb.gz	The Structure of the Outer Membrane Protein Ompx from Escherichia Coli Reveals Mechanisms of Virulence
19	PDB:4gwpF	0.037	0.159	3.876E-1	209	0.012	0.081	4gwpF.pdb.gz
20	PDB:3s3sA	0.039	0.081	4.094E-1	620	0.008	0.019	3s3sA.pdb.gz	Inhibitors of Transglutaminase 2: A therapeutic option in celiac disease

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TUF7	0.0	2378	1407	0.866	0.875	YETS2_MOUSE YEATS domain-containing protein 2 OS=Mus musculus OX=10090 GN=Yeats2 PE=1 SV=2
2	Q9ULM3	0.0	2896	1422	1.000	1.000	YETS2_HUMAN YEATS domain-containing protein 2 OS=Homo sapiens OX=9606 GN=YEATS2 PE=1 SV=2
3	Q9VLL1	6.43e-39	160	969	0.075	0.110	Q9VLL1_DROME D12 OS=Drosophila melanogaster OX=7227 GN=D12 PE=4 SV=1
4	Q95R51	7.78e-39	160	969	0.075	0.110	Q95R51_DROME SD07884p OS=Drosophila melanogaster OX=7227 GN=D12 PE=2 SV=1
5	Q7KA77	6.76e-30	130	737	0.043	0.083	Q7KA77_DROME Uncharacterized protein D12 (Fragment) OS=Drosophila melanogaster OX=7227 GN=D12 PE=2 SV=1
6	Q9FH40	2.08e-15	80.5	268	0.044	0.231	TA14B_ARATH Transcription initiation factor TFIID subunit 14b OS=Arabidopsis thaliana OX=3702 GN=TAF14B PE=1 SV=1
7	P53930	8.17e-15	77.4	226	0.030	0.190	AF9_YEAST Protein AF-9 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAF9 PE=1 SV=1
8	Q9VM63	3.44e-13	72.8	227	0.029	0.181	Q9VM63_DROME Gas41 OS=Drosophila melanogaster OX=7227 GN=Gas41 PE=1 SV=2
9	O95619	4.78e-13	72.4	227	0.034	0.216	YETS4_HUMAN YEATS domain-containing protein 4 OS=Homo sapiens OX=9606 GN=YEATS4 PE=1 SV=1
10	Q9CR11	5.72e-13	72.0	227	0.034	0.216	YETS4_MOUSE YEATS domain-containing protein 4 OS=Mus musculus OX=10090 GN=Yeats4 PE=2 SV=1
11	F4IPK2	4.68e-12	70.5	268	0.032	0.168	TAF14_ARATH Transcription initiation factor TFIID subunit 14 OS=Arabidopsis thaliana OX=3702 GN=TAF14 PE=1 SV=1
12	Q21501	2.09e-11	67.4	211	0.027	0.180	Q21501_CAEEL YEATS domain-containing protein 4 OS=Caenorhabditis elegans OX=6239 GN=gfl-1 PE=1 SV=1
13	Q10319	6.63e-10	62.8	217	0.027	0.180	AF9_SCHPO Protein AF-9 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yaf9 PE=3 SV=1
14	Q03111	2.86e-09	63.9	559	0.023	0.059	ENL_HUMAN Protein ENL OS=Homo sapiens OX=9606 GN=MLLT1 PE=1 SV=2
15	Q59LC9	5.44e-09	60.8	254	0.024	0.134	AF9_CANAL Protein AF-9 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YAF9 PE=3 SV=1
16	Q9ERL0	1.66e-08	61.2	547	0.023	0.059	Q9ERL0_MOUSE Btk-PH-domain binding protein OS=Mus musculus OX=10090 GN=Mllt1 PE=1 SV=1
17	Q9EPX7	1.91e-08	61.2	547	0.023	0.059	Q9EPX7_MOUSE Leukemia associated gene protein OS=Mus musculus OX=10090 GN=Mllt1 PE=2 SV=1
18	Q57ZF8	2.15e-07	58.2	662	0.020	0.042	Q57ZF8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27E10.610 PE=4 SV=1
19	A2AM29	4.41e-07	57.0	569	0.020	0.051	AF9_MOUSE Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1
20	A0A0B4KG69	5.77e-07	56.6	945	0.022	0.033	A0A0B4KG69_DROME ENL/AF9-related, isoform B OS=Drosophila melanogaster OX=7227 GN=ear PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20305 pYEATS	2.1e-08	45.2	prokaryotic YEATS domain
2	PF03366 YEATS	2.1e-21	87.0	YEATS family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306983

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316114	0.996	SAGA-associated factor 29
2	9606.ENSP00000351446	0.994	WD repeat-containing protein 5
3	9606.ENSP00000481091	0.994	Transcriptional adapter 2-alpha
4	9606.ENSP00000307684	0.992	Transcriptional adapter 3
5	9606.ENSP00000392318	0.990	Cysteine-rich protein 2-binding protein
6	9606.ENSP00000399718	0.985	MAP3K12-binding inhibitory protein 1
7	9606.ENSP00000225916	0.984	Histone acetyltransferase KAT2A
8	9606.ENSP00000263754	0.980	Histone acetyltransferase KAT2B
9	9606.ENSP00000308022	0.970	Transcriptional adapter 2-beta
10	9606.ENSP00000359295	0.970	Protein Dr1
11	9606.ENSP00000361363	0.956	DNA methyltransferase 1-associated protein 1
12	9606.ENSP00000359837	0.950	ZZ-type zinc finger-containing protein 3
13	9606.ENSP00000380157	0.929	Molybdopterin synthase catalytic subunit
14	9606.ENSP00000363286	0.928	DNA polymerase epsilon subunit 3
15	9606.ENSP00000420176	0.905	DNA polymerase epsilon subunit 4
16	9606.ENSP00000352925	0.904	Transformation/transcription domain-associated protein
17	9606.ENSP00000263974	0.900	Transcription initiation factor TFIID subunit 12
18	9606.ENSP00000397552	0.891	Actin-like protein 6A
19	9606.ENSP00000340330	0.885	Histone acetyltransferase KAT5
20	9606.ENSP00000374213	0.869	E1A-binding protein p400

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140030	1.000	modification-dependent protein binding
GO:0042393	1.000	histone binding
GO:0017025	1.000	TBP-class protein binding
GO:0003676	0.335	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0043412	0.982	macromolecule modification
GO:0080090	0.978	regulation of primary metabolic process
GO:0051726	0.970	regulation of cell cycle
GO:0036211	0.969	protein modification process
GO:0006355	0.966	regulation of DNA-templated transcription
GO:0051302	0.950	regulation of cell division
GO:0016573	0.943	histone acetylation
GO:0006357	0.921	regulation of transcription by RNA polymerase II
GO:0048519	0.913	negative regulation of biological process
GO:0048523	0.812	negative regulation of cellular process
GO:0009987	0.797	cellular process
GO:0048518	0.538	positive regulation of biological process
GO:0048522	0.531	positive regulation of cellular process
GO:0043966	0.517	histone H3 acetylation
GO:0009893	0.506	positive regulation of metabolic process
GO:0051173	0.502	positive regulation of nitrogen compound metabolic process
GO:0031325	0.489	positive regulation of cellular metabolic process
GO:0010604	0.430	positive regulation of macromolecule metabolic process
GO:0010605	0.386	negative regulation of macromolecule metabolic process
GO:0031399	0.386	regulation of protein modification process
GO:0051172	0.380	negative regulation of nitrogen compound metabolic process
GO:0031324	0.376	negative regulation of cellular metabolic process
GO:0045935	0.355	positive regulation of nucleobase-containing compound metabolic process
GO:0031056	0.336	regulation of histone modification
GO:0045934	0.320	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.311	negative regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140672	1.000	ATAC complex
GO:0005634	0.984	nucleus
GO:0140513	0.816	nuclear protein-containing complex
GO:0031981	0.597	nuclear lumen
GO:0005654	0.581	nucleoplasm
GO:0005856	0.464	cytoskeleton
GO:0015630	0.342	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]