StarFunc result for job id Q9ULM6

User Input

>input (557 residues)
MPKEKYEPPDPRRMYTIMSSEEAANGKKSHWAELEISGKVRSLSASLWSLTHLTALHLSD
NSLSRIPSDIAKLHNLVYLDLSSNKIRSLPAELGNMVSLRELHLNNNLLRVLPFELGKLF
QLQTLGLKGNPLTQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEP
DRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIVSLQE
VETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTV
EFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKESIEMPSGKPHLGTEKQLILVANA
HMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRNLKSSVLGEFGTIPLVLCADLNSLPDSG
VVEYLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFKLQSAYESGLMPYT
NYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL
LLPFLPQVNGIHLPGRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULM6	1.000	1.000	0.000	557	1.000	1.000	Q9ULM6.pdb.gz	CNOT6_HUMAN CCR4-NOT transcription complex subunit 6 OS=Homo sapiens OX=9606 GN=CNOT6 PE=1 SV=2
2	AFDB:Q8VEG6	0.943	0.946	7.285E-93	555	0.770	0.773	Q8VEG6.pdb.gz	CNO6L_MOUSE CCR4-NOT transcription complex subunit 6-like OS=Mus musculus OX=10090 GN=Cnot6l PE=1 SV=2
3	PDB:7ax1A	0.638	0.684	8.293E-90	518	0.926	0.996	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
4	AFDB:Q8IMX1	0.930	0.913	1.758E-80	567	0.560	0.550	Q8IMX1.pdb.gz	Q8IMX1_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
5	AFDB:Q9U1P4	0.878	0.800	4.852E-74	613	0.469	0.426	Q9U1P4.pdb.gz	Q9U1P4_CAEEL poly(A)-specific ribonuclease OS=Caenorhabditis elegans OX=6239 GN=ccr-4 PE=1 SV=2
6	AFDB:O74874	0.761	0.624	1.632E-57	690	0.386	0.312	O74874.pdb.gz	CCR4_SCHPO CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ccr4 PE=1 SV=1
7	AFDB:P31384	0.719	0.493	1.426E-51	837	0.320	0.213	P31384.pdb.gz	CCR4_YEAST CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCR4 PE=1 SV=2
8	AFDB:Q8W0Z9	0.558	0.519	4.529E-35	602	0.233	0.216	Q8W0Z9.pdb.gz	CCR4A_ARATH Carbon catabolite repressor protein 4 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=CCR4-1 PE=2 SV=1
9	AFDB:F4J8R6	0.525	0.644	4.983E-29	449	0.183	0.227	F4J8R6.pdb.gz	F4J8R6_ARATH DNAse I-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=CCR4C PE=1 SV=1
10	AFDB:A0A024R6B2	0.519	0.437	4.428E-28	670	0.194	0.161	A0A024R6B2.pdb.gz
11	AFDB:Q5VTE6	0.514	0.525	1.246E-27	544	0.190	0.195	Q5VTE6.pdb.gz	ANGE2_HUMAN Protein angel homolog 2 OS=Homo sapiens OX=9606 GN=ANGEL2 PE=1 SV=1
12	PDB:7voiC	0.279	0.850	9.363E-21	180	0.246	0.761	7voiC.pdb.gz
13	PDB:4f1iA	0.311	0.491	1.920E-11	328	0.084	0.143	4f1iA.pdb.gz
14	PDB:1akoA	0.293	0.549	7.180E-10	268	0.101	0.209	1akoA.pdb.gz
15	PDB:4awnA	0.277	0.505	1.070E-8	260	0.077	0.165	4awnA.pdb.gz	The Structure of Human DNase I Bound to Magnesium and Phosphate Ions Points to a Catalytic Mechanism Common to Members of the DNase I-Like Superfamily.
16	PDB:7cd5A	0.304	0.530	2.685E-8	278	0.095	0.191	7cd5A.pdb.gz	APE1 distinguishes DNA substrates in exonucleolytic cleavage by induced space-filling.
17	PDB:7lt9A	0.181	0.395	8.977E-8	251	0.075	0.167	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
18	PDB:7kiuA	0.291	0.534	1.067E-7	263	0.061	0.129	7kiuA.pdb.gz	Structural features of Dnase1L3 responsible for serum antigen clearance.
19	PDB:2j63A	0.312	0.474	1.342E-7	333	0.074	0.123	2j63A.pdb.gz
20	PDB:2a3zB	0.287	0.532	1.689E-7	260	0.081	0.173	2a3zB.pdb.gz	Actin-bound structures of Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 and the implications for filament assembly

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y9C1	0.0	693	435	0.627	0.802	H0Y9C1_HUMAN poly(A)-specific ribonuclease OS=Homo sapiens OX=9606 GN=CNOT6L PE=1 SV=2
2	H0Y9Z5	0.0	871	550	0.785	0.795	H0Y9Z5_HUMAN poly(A)-specific ribonuclease OS=Homo sapiens OX=9606 GN=CNOT6L PE=1 SV=2
3	Q7K112	0.0	640	552	0.557	0.562	Q7K112_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
4	Q8IMX1	0.0	640	567	0.557	0.547	Q8IMX1_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
5	Q8MTZ5	0.0	628	566	0.557	0.548	Q8MTZ5_DROME poly(A)-specific ribonuclease (Fragment) OS=Drosophila melanogaster OX=7227 GN=twin PE=2 SV=1
6	Q8VEG6	0.0	885	555	0.770	0.773	CNO6L_MOUSE CCR4-NOT transcription complex subunit 6-like OS=Mus musculus OX=10090 GN=Cnot6l PE=1 SV=2
7	Q96LI5	0.0	871	555	0.785	0.787	CNO6L_HUMAN CCR4-NOT transcription complex subunit 6-like OS=Homo sapiens OX=9606 GN=CNOT6L PE=1 SV=2
8	Q9U1P4	0.0	546	613	0.476	0.432	Q9U1P4_CAEEL poly(A)-specific ribonuclease OS=Caenorhabditis elegans OX=6239 GN=ccr-4 PE=1 SV=2
9	Q9ULM6	0.0	1156	557	1.000	1.000	CNOT6_HUMAN CCR4-NOT transcription complex subunit 6 OS=Homo sapiens OX=9606 GN=CNOT6 PE=1 SV=2
10	Q9VCB6	0.0	640	545	0.557	0.569	Q9VCB6_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=2
11	Q8IMX0	8.96e-149	433	358	0.372	0.578	Q8IMX0_DROME Twin, isoform D OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
12	O74874	1.62e-121	375	690	0.388	0.313	CCR4_SCHPO CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ccr4 PE=1 SV=1
13	P31384	1.77e-94	308	837	0.339	0.226	CCR4_YEAST CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCR4 PE=1 SV=2
14	Q8W0Z9	1.69e-50	185	602	0.233	0.216	CCR4A_ARATH Carbon catabolite repressor protein 4 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=CCR4-1 PE=2 SV=1
15	Q6L8Q7	1.17e-33	137	609	0.180	0.164	PDE12_HUMAN 2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12 PE=1 SV=2
16	Q08DF7	2.30e-33	136	609	0.178	0.163	PDE12_BOVIN 2',5'-phosphodiesterase 12 OS=Bos taurus OX=9913 GN=PDE12 PE=1 SV=1
17	Q3TIU4	2.61e-32	133	608	0.181	0.166	PDE12_MOUSE 2',5'-phosphodiesterase 12 OS=Mus musculus OX=10090 GN=Pde12 PE=1 SV=2
18	F4J8R6	2.39e-29	122	449	0.203	0.252	F4J8R6_ARATH DNAse I-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=CCR4C PE=1 SV=1
19	A8MS41	5.35e-26	112	417	0.180	0.240	CCR4D_ARATH Carbon catabolite repressor protein 4 homolog 4 OS=Arabidopsis thaliana OX=3702 GN=CCR4-4 PE=1 SV=1
20	Q5VTE6	8.82e-23	104	544	0.127	0.131	ANGE2_HUMAN Protein angel homolog 2 OS=Homo sapiens OX=9606 GN=ANGEL2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03372 Exo_endo_phos	2.2e-18	78.3	Endonuclease/Exonuclease/phosphatase family
2	PF00560 LRR_1	13	17.6	Leucine Rich Repeat
3	PF12799 LRR_4	8.7e-08	43.6	Leucine Rich repeats (2 copies)
4	PF13516 LRR_6	1.3e+02	14.1	Leucine Rich repeat
5	PF13855 LRR_8	1e-07	42.9	Leucine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377024

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229195	0.999	CCR4-NOT transcription complex subunit 2
2	9606.ENSP00000273064	0.999	CCR4-NOT transcription complex subunit 9
3	9606.ENSP00000320949	0.999	CCR4-NOT transcription complex subunit 1
4	9606.ENSP00000351159	0.999	CCR4-NOT transcription complex subunit 3
5	9606.ENSP00000355279	0.999	CCR4-NOT transcription complex subunit 7
6	9606.ENSP00000430493	0.999	CCR4-NOT transcription complex subunit 8
7	9606.ENSP00000289382	0.990	CCR4-NOT transcription complex subunit 11
8	9606.ENSP00000445508	0.990	CCR4-NOT transcription complex subunit 4
9	9606.ENSP00000399862	0.983	CCR4-NOT transcription complex subunit 10
10	9606.ENSP00000313007	0.982	Polyadenylate-binding protein 1
11	9606.ENSP00000437271	0.968	182 kDa tankyrase-1-binding protein
12	9606.ENSP00000424896	0.967	CCR4-NOT transcription complex subunit 6-like
13	9606.ENSP00000427695	0.966	Protein Tob1
14	9606.ENSP00000425561	0.952	Eukaryotic translation initiation factor 4E
15	9606.ENSP00000416255	0.944	Eukaryotic translation initiation factor 4 gamma 1
16	9606.ENSP00000326381	0.928	Eukaryotic initiation factor 4A-II
17	9606.ENSP00000482128	0.923	Cytoplasmic polyadenylation element-binding protein 3
18	9606.ENSP00000293831	0.922	Eukaryotic initiation factor 4A-I
19	9606.ENSP00000388806	0.916	Eukaryotic translation initiation factor 4B
20	9606.ENSP00000269349	0.910	Eukaryotic initiation factor 4A-III

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004535	1.000	poly(A)-specific ribonuclease activity
GO:0140110	0.880	transcription regulator activity
GO:0003713	0.851	transcription coactivator activity
GO:0030374	0.600	nuclear receptor coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0048522	0.989	positive regulation of cellular process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0048523	0.987	negative regulation of cellular process
GO:0010468	0.987	regulation of gene expression
GO:0010556	0.985	regulation of macromolecule biosynthetic process
GO:0031326	0.985	regulation of cellular biosynthetic process
GO:0044237	0.984	cellular metabolic process
GO:0010605	0.984	negative regulation of macromolecule metabolic process
GO:0006807	0.979	nitrogen compound metabolic process
GO:0051252	0.977	regulation of RNA metabolic process
GO:0051173	0.976	positive regulation of nitrogen compound metabolic process
GO:0010604	0.976	positive regulation of macromolecule metabolic process
GO:0043170	0.975	macromolecule metabolic process
GO:0051172	0.973	negative regulation of nitrogen compound metabolic process
GO:0031324	0.973	negative regulation of cellular metabolic process
GO:0031325	0.972	positive regulation of cellular metabolic process
GO:0065008	0.962	regulation of biological quality
GO:0034641	0.962	cellular nitrogen compound metabolic process
GO:0051246	0.961	regulation of protein metabolic process
GO:0016071	0.952	mRNA metabolic process
GO:0031327	0.951	negative regulation of cellular biosynthetic process
GO:0044260	0.950	cellular macromolecule metabolic process
GO:0010558	0.947	negative regulation of macromolecule biosynthetic process
GO:0010608	0.946	post-transcriptional regulation of gene expression
GO:0000289	0.940	nuclear-transcribed mRNA poly(A) tail shortening
GO:0042127	0.668	regulation of cell population proliferation
GO:0016441	0.651	post-transcriptional gene silencing
GO:0051128	0.645	regulation of cellular component organization
GO:0044087	0.608	regulation of cellular component biogenesis
GO:1902115	0.604	regulation of organelle assembly
GO:0008284	0.551	positive regulation of cell population proliferation
GO:0044089	0.546	positive regulation of cellular component biogenesis
GO:1902117	0.517	positive regulation of organelle assembly
GO:0031047	0.515	RNA-mediated gene silencing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.999	protein-containing complex
GO:0140535	0.977	intracellular protein-containing complex
GO:0030014	0.970	CCR4-NOT complex
GO:0016020	0.928	membrane
GO:0043229	0.849	intracellular organelle
GO:0043227	0.848	membrane-bounded organelle
GO:0005634	0.834	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.13.4	1.000	poly(A)-specific ribonuclease.

[back to server]