StarFunc result for job id Q9ULP9

User Input

>input (559 residues)
MDSPGYNCFVDKDKMDAAIQDLGPKELSCTELQELKQLARQGYWAQSHALRGKVYQRLIR
DIPCRTVTPDASVYSDIVGKIVGKHSSSCLPLPEFVDNTQVPSYCLNARGEGAVRKILLC
LANQFPDISFCPALPAVVALLLHYSIDEAECFEKACRILACNDPGRRLIDQSFLAFESSC
MTFGDLVNKYCQAAHKLMVAVSEDVLQVYADWQRWLFGELPLCYFARVFDVFLVEGYKVL
YRVALAILKFFHKVRAGQPLESDSVKQDIRTFVRDIAKTVSPEKLLEKAFAIRLFSRKEI
QLLQMANEKALKQKGITVKQKSVSLSKRQFVHLAVHAENFRSEIVSVREMRDIWSWVPER
FALCQPLLLFSSLQHGYSLARFYFQCEGHEPTLLLIKTTQKEVCGAYLSTDWSERNKFGG
KLGFFGTGECFVFRLQPEVQRYEWVVIKHPELTKPPPLMAAEPTAPLSHSASSDPADRLS
PFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDLNRGRTSHCDTFNNQPLCS
ENFLIAAVEAWGFQDPDTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K5B0	0.949	0.944	1.001E-82	562	0.936	0.931	A0A0G2K5B0.pdb.gz	A0A0G2K5B0_RAT TBC1 domain family member 24 OS=Rattus norvegicus OX=10116 GN=Tbc1d24 PE=1 SV=1
2	AFDB:M9PDI9	0.482	0.446	8.477E-34	606	0.297	0.274	M9PDI9.pdb.gz	M9PDI9_DROME Skywalker, isoform L OS=Drosophila melanogaster OX=7227 GN=sky PE=4 SV=1
3	AFDB:Q9VIH6	0.476	0.451	5.186E-33	592	0.301	0.284	Q9VIH6.pdb.gz	Q9VIH6_DROME Skywalker, isoform C OS=Drosophila melanogaster OX=7227 GN=sky PE=4 SV=2
4	AFDB:Q6Q4F0	0.467	0.456	1.226E-32	573	0.286	0.279	Q6Q4F0.pdb.gz	Q6Q4F0_DROME CG9339-PH OS=Drosophila melanogaster OX=7227 GN=sky PE=2 SV=1
5	AFDB:Q8N573	0.274	0.176	8.474E-14	874	0.116	0.074	Q8N573.pdb.gz	OXR1_HUMAN Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1 PE=1 SV=2
6	AFDB:Q7KTR8	0.270	0.556	2.750E-13	267	0.097	0.202	Q7KTR8.pdb.gz	Q7KTR8_DROME L82D OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
7	AFDB:A4V2F2	0.269	0.122	2.878E-13	1246	0.097	0.043	A4V2F2.pdb.gz	A4V2F2_DROME Mustard, isoform U OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
8	AFDB:Q8NI08	0.276	0.165	2.878E-13	942	0.097	0.057	Q8NI08.pdb.gz	NCOA7_HUMAN Nuclear receptor coactivator 7 OS=Homo sapiens OX=9606 GN=NCOA7 PE=1 SV=2
9	AFDB:Q4V8B0	0.281	0.188	3.297E-13	839	0.114	0.076	Q4V8B0.pdb.gz	OXR1_RAT Oxidation resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Oxr1 PE=1 SV=3
10	AFDB:Q4KMM3	0.275	0.179	4.526E-13	866	0.114	0.074	Q4KMM3.pdb.gz	OXR1_MOUSE Oxidation resistance protein 1 OS=Mus musculus OX=10090 GN=Oxr1 PE=1 SV=3
11	PDB:7uneU	0.285	0.366	4.874E-9	427	0.107	0.141	7uneU.pdb.gz
12	PDB:7fdeP	0.247	0.727	2.850E-8	181	0.082	0.254	7fdeP.pdb.gz
13	PDB:4z6yA	0.302	0.551	2.351E-3	273	0.091	0.187	4z6yA.pdb.gz
14	PDB:1rqiA	0.122	0.180	1.988E-1	300	0.070	0.130	1rqiA.pdb.gz	Structural basis for bisphosphonate-mediated inhibition of isoprenoid biosynthesis
15	PDB:6rqlA	0.067	0.032	3.748E-1	1542	0.107	0.039	6rqlA.pdb.gz	Molecular insight into RNA polymerase I promoter recognition and promoter melting.
16	PDB:5n9jY	0.068	0.155	5.894E-1	185	0.034	0.103	5n9jY.pdb.gz
17	PDB:3ay5A	0.103	0.158	8.092E-1	298	0.089	0.168	3ay5A.pdb.gz
18	PDB:6ob6B	0.110	0.146	9.270E-1	357	0.073	0.115	6ob6B.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.
19	PDB:6qexA	0.085	0.052	1.111	1182	0.079	0.037	6qexA.pdb.gz	Structural insight into substrate and inhibitor discrimination by human P-glycoprotein.
20	PDB:6xboA	0.083	0.124	1.162	319	0.055	0.097	6xboA.pdb.gz	Inhibition of CMP-sialic acid transport by endogenous 5-methyl CMP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K5B0	0.0	1092	562	0.936	0.931	A0A0G2K5B0_RAT TBC1 domain family member 24 OS=Rattus norvegicus OX=10116 GN=Tbc1d24 PE=1 SV=1
2	D4A3Z3	0.0	1075	556	0.925	0.930	D4A3Z3_RAT TBC1 domain family member 24 OS=Rattus norvegicus OX=10116 GN=Tbc1d24 PE=4 SV=1
3	Q3UUG6	0.0	1077	561	0.925	0.922	TBC24_MOUSE TBC1 domain family member 24 OS=Mus musculus OX=10090 GN=Tbc1d24 PE=1 SV=2
4	Q9ULP9	0.0	1161	559	1.000	1.000	TBC24_HUMAN TBC1 domain family member 24 OS=Homo sapiens OX=9606 GN=TBC1D24 PE=1 SV=2
5	Q0E8N9	9.73e-79	260	568	0.311	0.306	Q0E8N9_DROME Skywalker, isoform D OS=Drosophila melanogaster OX=7227 GN=sky PE=4 SV=1
6	Q9VIH7	2.01e-74	249	587	0.315	0.300	SKY_DROME GTPase-activating protein skywalker OS=Drosophila melanogaster OX=7227 GN=sky PE=1 SV=2
7	M9PDV9	3.77e-74	249	597	0.311	0.291	M9PDV9_DROME Skywalker, isoform K OS=Drosophila melanogaster OX=7227 GN=sky PE=4 SV=1
8	Q9VIH6	4.16e-74	248	592	0.315	0.297	Q9VIH6_DROME Skywalker, isoform C OS=Drosophila melanogaster OX=7227 GN=sky PE=4 SV=2
9	Q6Q4F0	1.33e-73	246	573	0.297	0.290	Q6Q4F0_DROME CG9339-PH OS=Drosophila melanogaster OX=7227 GN=sky PE=2 SV=1
10	M9PDI9	4.48e-73	246	606	0.315	0.290	M9PDI9_DROME Skywalker, isoform L OS=Drosophila melanogaster OX=7227 GN=sky PE=4 SV=1
11	A2ACG1	8.74e-16	78.2	198	0.106	0.298	TLDC2_MOUSE TLD domain-containing protein 2 OS=Mus musculus OX=10090 GN=Tldc2 PE=3 SV=1
12	Q8IPN7	3.42e-15	77.0	213	0.100	0.263	Q8IPN7_DROME L82E OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
13	Q8IPN6	6.14e-15	75.5	192	0.100	0.292	Q8IPN6_DROME L82G OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
14	Q7KTR7	7.31e-15	75.9	210	0.100	0.267	Q7KTR7_DROME L82F OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
15	H2L003	1.29e-14	79.3	840	0.114	0.076	H2L003_CAEEL LysM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lmd-3 PE=1 SV=1
16	Q7KTR8	1.53e-14	76.3	267	0.100	0.210	Q7KTR8_DROME L82D OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
17	Q8IPN9	1.67e-14	79.3	1055	0.100	0.053	Q8IPN9_DROME Mustard, isoform K OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
18	Q8MSQ5	1.99e-14	79.0	1033	0.100	0.054	Q8MSQ5_DROME Mustard, isoform G OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
19	Q7KNC5	2.07e-14	79.0	1025	0.100	0.055	Q7KNC5_DROME L82B OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
20	Q4ABH3	2.30e-14	79.0	1012	0.100	0.055	Q4ABH3_DROME Mustard, isoform M OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00566 RabGAP-TBC	6e-26	103.0	Rab-GTPase-TBC domain
2	PF07534 TLD	8.2e-23	92.6	TLD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000293970

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229340	0.976	Ras-related protein Rab-35
2	9606.ENSP00000298316	0.964	ADP-ribosylation factor 6
3	9606.ENSP00000360822	0.736	Potassium channel subfamily T member 1
4	9606.ENSP00000303540	0.715	Sodium channel protein type 1 subunit alpha
5	9606.ENSP00000302441	0.710	N-acylneuraminate-9-phosphatase
6	9606.ENSP00000294725	0.686	Potassium channel subfamily T member 2
7	9606.ENSP00000322020	0.660	Mitochondrial glutamate carrier 1
8	9606.ENSP00000361731	0.632	TBC1 domain family member 13
9	9606.ENSP00000364782	0.632	Sialidase-1
10	9606.ENSP00000353549	0.626	Cell division cycle protein 16 homolog
11	9606.ENSP00000345464	0.591	E3 ubiquitin-protein ligase NHLRC1
12	9606.ENSP00000343635	0.590	TLD domain-containing protein 1
13	9606.ENSP00000338185	0.585	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
14	9606.ENSP00000387694	0.577	Solute carrier family 12 member 5
15	9606.ENSP00000273968	0.576	Protein preY, mitochondrial
16	9606.ENSP00000460380	0.573	Ubiquitin carboxyl-terminal hydrolase 6
17	9606.ENSP00000248248	0.567	MON1 homolog B, secretory trafficking associated
18	9606.ENSP00000273047	0.547	Ras-related protein Rab-5A
19	9606.ENSP00000346534	0.543	Sodium channel protein type 8 subunit alpha
20	9606.ENSP00000439287	0.527	Regulating synaptic membrane exocytosis protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030695	0.767	GTPase regulator activity
GO:0140677	0.741	molecular function activator activity
GO:0005096	0.725	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0065007	0.971	biological regulation
GO:0050789	0.959	regulation of biological process
GO:0050896	0.941	response to stimulus
GO:0032501	0.939	multicellular organismal process
GO:0050794	0.933	regulation of cellular process
GO:0071840	0.887	cellular component organization or biogenesis
GO:0016043	0.872	cellular component organization
GO:0070997	0.868	neuron death
GO:0007275	0.855	multicellular organism development
GO:0007399	0.829	nervous system development
GO:0006979	0.814	response to oxidative stress
GO:0048518	0.803	positive regulation of biological process
GO:2001222	0.771	regulation of neuron migration
GO:0048583	0.739	regulation of response to stimulus
GO:0051716	0.735	cellular response to stimulus
GO:0030030	0.701	cell projection organization
GO:0051179	0.696	localization
GO:0031344	0.687	regulation of cell projection organization
GO:0051239	0.680	regulation of multicellular organismal process
GO:0120036	0.667	plasma membrane bounded cell projection organization
GO:0048869	0.650	cellular developmental process
GO:0048522	0.644	positive regulation of cellular process
GO:0034599	0.635	cellular response to oxidative stress
GO:0030154	0.626	cell differentiation
GO:0010646	0.591	regulation of cell communication
GO:0023051	0.588	regulation of signaling
GO:0065008	0.586	regulation of biological quality
GO:0006810	0.570	transport
GO:0009966	0.562	regulation of signal transduction
GO:0080134	0.558	regulation of response to stress
GO:0042391	0.545	regulation of membrane potential
GO:0022008	0.539	neurogenesis
GO:0031175	0.533	neuron projection development
GO:0012501	0.513	programmed cell death
GO:0120035	0.499	regulation of plasma membrane bounded cell projection organization
GO:0010769	0.497	regulation of cell morphogenesis involved in differentiation
GO:0048814	0.486	regulation of dendrite morphogenesis
GO:0010770	0.473	positive regulation of cell morphogenesis involved in differentiation
GO:2001224	0.472	positive regulation of neuron migration
GO:0031644	0.468	regulation of nervous system process
GO:0050775	0.454	positive regulation of dendrite morphogenesis
GO:0098815	0.451	modulation of excitatory postsynaptic potential
GO:0048584	0.390	positive regulation of response to stimulus
GO:0010647	0.388	positive regulation of cell communication
GO:0023056	0.382	positive regulation of signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0030054	0.998	cell junction
GO:0005886	0.995	plasma membrane
GO:0043227	0.760	membrane-bounded organelle
GO:0043231	0.733	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]