StarFunc result for job id Q9ULQ1

User Input

>input (816 residues)
MAVSLDDDVPLILTLDEGGSAPLAPSNGLGQEELPSKNGGSYAIHDSQAPSLSSGGESSP
SSPAHNWEMNYQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL
LLSLCEAPAVPALRLGIYVHATLELFALMVVVFELCMKLRWLGLHTFIRHKRTMVKTSVL
VVQFVEAIVVLVRQMSHVRVTRALRCIFLVDCRYCGGVRRNLRQIFQSLPPFMDILLLLL
FFMIIFAILGFYLFSPNPSDPYFSTLENSIVSLFVLLTTANFPDVMMPSYSRNPWSCVFF
IVYLSIELYFIMNLLLAVVFDTFNDIEKRKFKSLLLHKRTAIQHAYRLLISQRRPAGISY
RQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAALKWKAKKNREHWF
DELPRTALLIFKGINILVKSKAFQYFMYLVVAVNGVWILVETFMLKGGNFFSKHVPWSYL
VFLTIYGVELFLKVAGLGPVEYLSSGWNLFDFSVTVFAFLGLLALALNMEPFYFIVVLRP
LQLLRLFKLKERYRNVLDTMFELLPRMASLGLTLLIFYYSFAIVGMEFFCGIVFPNCCNT
STVADAYRWRNHTVGNRTVVEEGYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQT
SHWSRLYFMTFYIVTMVVMTIIVAFILEAFVFRMNYSRKNQDSEVDGGITLEKEISKEEL
VAVLELYREARGASSDVTRLLETLSQMERYQQHSMVFLGRRSRTKSDLSLKMYQEEIQEW
YEEHAREQEQQRQLSSSAAPAAQQPPGSRQRSQTVT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9EQJ0	0.888	0.887	4.179E-85	817	0.911	0.909	Q9EQJ0.pdb.gz	TPC1_MOUSE Two pore calcium channel protein 1 OS=Mus musculus OX=10090 GN=Tpcn1 PE=1 SV=1
2	PDB:6c9aB	0.876	0.989	6.732E-78	723	0.819	0.924	6c9aB.pdb.gz	Structural insights into the voltage and phospholipid activation of the mammalian TPC1 channel.
3	AFDB:C4IXV6	0.690	0.726	7.282E-29	773	0.222	0.234	C4IXV6.pdb.gz	C4IXV6_DANRE Two pore channel 3 OS=Danio rerio OX=7955 GN=TPC3 PE=1 SV=1
4	AFDB:Q8NHX9	0.673	0.726	5.913E-25	752	0.224	0.243	Q8NHX9.pdb.gz	TPC2_HUMAN Two pore channel protein 2 OS=Homo sapiens OX=9606 GN=TPCN2 PE=1 SV=2
5	AFDB:A0JMD4	0.672	0.707	2.850E-23	774	0.202	0.213	A0JMD4.pdb.gz	TPC2_DANRE Two pore channel protein 2 OS=Danio rerio OX=7955 GN=tpcn2 PE=2 SV=1
6	AFDB:Q94KI8	0.595	0.653	1.432E-22	733	0.212	0.236	Q94KI8.pdb.gz	TPC1_ARATH Two pore calcium channel protein 1 OS=Arabidopsis thaliana OX=3702 GN=TPC1 PE=1 SV=1
7	PDB:6nq0A	0.655	0.847	4.445E-21	621	0.195	0.256	6nq0A.pdb.gz	Structural mechanisms of phospholipid activation of the human TPC2 channel.
8	AFDB:D3ZTJ6	0.643	0.732	4.611E-21	711	0.191	0.219	D3ZTJ6.pdb.gz	D3ZTJ6_RAT Two pore segment channel 2 OS=Rattus norvegicus OX=10116 GN=Tpcn2 PE=4 SV=1
9	PDB:7fhkA	0.544	0.651	1.121E-18	663	0.196	0.241	7fhkA.pdb.gz	Voltage-gating and cytosolic Ca 2+ activation mechanisms of Arabidopsis two-pore channel AtTPC1.
10	PDB:7tdfA	0.526	0.695	1.820E-18	594	0.183	0.251	7tdfA.pdb.gz
11	PDB:7tddB	0.540	0.700	7.452E-16	606	0.181	0.244	7tddB.pdb.gz
12	PDB:6e1pA	0.548	0.674	1.029E-15	646	0.181	0.229	6e1pA.pdb.gz	Structural basis for activation of voltage sensor domains in an ion channel TPC1.
13	AFDB:Q7Z003	0.506	0.237	4.386E-15	1885	0.183	0.079	Q7Z003.pdb.gz	Q7Z003_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
14	AFDB:Q9P0X4	0.507	0.203	6.567E-15	2223	0.175	0.064	Q9P0X4.pdb.gz	CAC1I_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1I OS=Homo sapiens OX=9606 GN=CACNA1I PE=1 SV=1
15	AFDB:F1MAS6	0.499	0.754	7.717E-15	525	0.140	0.217	F1MAS6.pdb.gz	F1MAS6_RAT Two pore segment channel 2 OS=Rattus norvegicus OX=10116 GN=Tpcn2 PE=4 SV=3
16	AFDB:Q9Z0Y8	0.505	0.204	9.443E-15	2201	0.170	0.063	Q9Z0Y8.pdb.gz	CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus OX=10116 GN=Cacna1i PE=1 SV=3
17	PDB:6v1qA	0.546	0.809	5.378E-14	538	0.185	0.281	6v1qA.pdb.gz	Resting state structure of the hyperdepolarization activated two-pore channel 3.
18	PDB:6e1kA	0.495	0.729	3.733E-13	536	0.148	0.226	6e1kA.pdb.gz	Structural basis for activation of voltage sensor domains in an ion channel TPC1.
19	PDB:7vfsA	0.480	0.321	4.944E-12	1266	0.175	0.113	7vfsA.pdb.gz	Closed-state inactivation and pore-blocker modulation mechanisms of human Ca V 2.2.
20	PDB:7mixA	0.485	0.310	1.728E-11	1326	0.174	0.107	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9EQJ0	0.0	1494	817	0.911	0.909	TPC1_MOUSE Two pore calcium channel protein 1 OS=Mus musculus OX=10090 GN=Tpcn1 PE=1 SV=1
2	Q9ULQ1	0.0	1684	816	1.000	1.000	TPC1_HUMAN Two pore channel protein 1 OS=Homo sapiens OX=9606 GN=TPCN1 PE=1 SV=3
3	C4IXV6	8.00e-60	219	773	0.255	0.269	C4IXV6_DANRE Two pore channel 3 OS=Danio rerio OX=7955 GN=TPC3 PE=1 SV=1
4	Q94KI8	2.08e-47	182	733	0.197	0.220	TPC1_ARATH Two pore calcium channel protein 1 OS=Arabidopsis thaliana OX=3702 GN=TPC1 PE=1 SV=1
5	Q8BWC0	2.50e-39	158	731	0.224	0.250	TPC2_MOUSE Two pore channel protein 2 OS=Mus musculus OX=10090 GN=Tpcn2 PE=1 SV=1
6	Q8NHX9	9.54e-35	144	752	0.213	0.231	TPC2_HUMAN Two pore channel protein 2 OS=Homo sapiens OX=9606 GN=TPCN2 PE=1 SV=2
7	F1MAS6	1.11e-33	140	733	0.213	0.237	F1MAS6_RAT Two pore segment channel 2 OS=Rattus norvegicus OX=10116 GN=Tpcn2 PE=4 SV=3
8	A0JMD4	2.56e-32	137	774	0.219	0.231	TPC2_DANRE Two pore channel protein 2 OS=Danio rerio OX=7955 GN=tpcn2 PE=2 SV=1
9	D3ZTJ6	2.51e-24	111	711	0.202	0.232	D3ZTJ6_RAT Two pore segment channel 2 OS=Rattus norvegicus OX=10116 GN=Tpcn2 PE=4 SV=1
10	Q05152	3.71e-19	95.9	2339	0.173	0.060	CAC1B_RABIT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Oryctolagus cuniculus OX=9986 GN=CACNA1B PE=1 SV=1
11	Q9NS89	3.52e-18	92.8	2472	0.163	0.054	Q9NS89_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha (Fragment) OS=Homo sapiens OX=9606 GN=CACNA1A PE=2 SV=1
12	P27884	3.79e-18	92.4	2424	0.169	0.057	CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus OX=9986 GN=CACNA1A PE=1 SV=1
13	O00555	6.98e-18	91.7	2506	0.167	0.054	CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens OX=9606 GN=CACNA1A PE=1 SV=3
14	P54282	1.83e-17	90.1	2212	0.162	0.060	CAC1A_RAT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Rattus norvegicus OX=10116 GN=Cacna1a PE=1 SV=1
15	P97445	2.41e-17	89.7	2368	0.162	0.056	CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus OX=10090 GN=Cacna1a PE=1 SV=2
16	Q02294	2.74e-17	89.7	2336	0.168	0.059	CAC1B_RAT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Rattus norvegicus OX=10116 GN=Cacna1b PE=1 SV=1
17	O55017	2.76e-17	89.7	2327	0.178	0.062	CAC1B_MOUSE Voltage-dependent N-type calcium channel subunit alpha-1B OS=Mus musculus OX=10090 GN=Cacna1b PE=1 SV=1
18	Q00975	3.11e-17	89.7	2339	0.180	0.063	CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens OX=9606 GN=CACNA1B PE=1 SV=1
19	O89089	5.36e-17	89.0	2333	0.179	0.063	O89089_RAT Voltage-dependent N-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1b PE=1 SV=1
20	M9NGR9	5.97e-17	88.6	3180	0.091	0.023	M9NGR9_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform D OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00520 Ion_trans	8.3e-55	197.2	Ion transport protein
2	PF07790 Pilin_N	1.3e+02	14.9	Archaeal Type IV pilin, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000010203

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000027967	0.865	Two pore segment channel 2
2	9593.ENSGGOP00000006029	0.822	CD38 molecule
3	9593.ENSGGOP00000014108	0.770	Unc-79 homolog, NALCN channel complex subunit
4	9593.ENSGGOP00000003517	0.663	Proto-oncogene tyrosine-protein kinase receptor Ret
5	9593.ENSGGOP00000014874	0.628	Calcium channel, voltage-dependent, beta 3 subunit
6	9593.ENSGGOP00000022383	0.617	Hyperpolarization activated cyclic nucleotide-gated potassium channel 3
7	9593.ENSGGOP00000027236	0.533	Calcium channel, voltage-dependent, beta 2 subunit
8	9593.ENSGGOP00000002064	0.529	Sodium channel, voltage-gated, type II, beta subunit
9	9593.ENSGGOP00000010385	0.527	Mucolipin 1
10	9593.ENSGGOP00000002046	0.525	Pituitary tumor-transforming 1 interacting protein
11	9593.ENSGGOP00000001738	0.521	Calcium channel, voltage-dependent, beta 4 subunit
12	9593.ENSGGOP00000007951	0.519	Patched 1
13	9593.ENSGGOP00000010664	0.516	Unc-80 homolog, NALCN channel complex subunit
14	9593.ENSGGOP00000006989	0.512	Calcium channel, voltage-dependent, alpha 2/delta subunit 2
15	9593.ENSGGOP00000001121	0.500	NIM1 serine/threonine protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0005217	1.000	intracellular ligand-gated monoatomic ion channel activity
GO:0005248	1.000	voltage-gated sodium channel activity
GO:0015280	1.000	ligand-gated sodium channel activity
GO:0015085	0.955	calcium ion transmembrane transporter activity
GO:0005262	0.954	calcium channel activity
GO:0043167	0.943	ion binding
GO:0043168	0.846	anion binding
GO:1901981	0.777	phosphatidylinositol phosphate binding
GO:0080025	0.774	phosphatidylinositol-3,5-bisphosphate binding
GO:0019905	0.744	syntaxin binding
GO:0099604	0.742	ligand-gated calcium channel activity
GO:0042803	0.728	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044000	0.993	movement in host
GO:0016032	0.991	viral process
GO:0009987	0.988	cellular process
GO:0050789	0.982	regulation of biological process
GO:0051179	0.974	localization
GO:0006811	0.955	monoatomic ion transport
GO:0050794	0.941	regulation of cellular process
GO:0046718	0.935	viral entry into host cell
GO:0046794	0.928	transport of virus
GO:0034220	0.920	monoatomic ion transmembrane transport
GO:0019222	0.875	regulation of metabolic process
GO:0006812	0.722	monoatomic cation transport
GO:0048518	0.710	positive regulation of biological process
GO:0030001	0.708	metal ion transport
GO:0009894	0.705	regulation of catabolic process
GO:0031323	0.664	regulation of cellular metabolic process
GO:0048522	0.566	positive regulation of cellular process
GO:0016192	0.564	vesicle-mediated transport
GO:0006897	0.547	endocytosis
GO:0009893	0.529	positive regulation of metabolic process
GO:0050896	0.513	response to stimulus
GO:0098660	0.477	inorganic ion transmembrane transport
GO:0098655	0.346	monoatomic cation transmembrane transport
GO:0098662	0.340	inorganic cation transmembrane transport
GO:0031325	0.312	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0098588	1.000	bounding membrane of organelle
GO:0031410	0.999	cytoplasmic vesicle
GO:0005773	0.997	vacuole
GO:0005764	0.994	lysosome
GO:0005768	0.994	endosome
GO:0030659	0.987	cytoplasmic vesicle membrane
GO:0010008	0.984	endosome membrane
GO:0036019	0.980	endolysosome
GO:0071944	0.884	cell periphery
GO:0005886	0.862	plasma membrane
GO:0005774	0.794	vacuolar membrane
GO:0098852	0.779	lytic vacuole membrane
GO:0005765	0.772	lysosomal membrane
GO:0005769	0.320	early endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)
RHEA:29671	0.955	Ca(2+)(in) = Ca(2+)(out)

[back to server]