StarFunc result for job id Q9ULT8

User Input

>input (2610 residues)
MADVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKI
FLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVELNNRTSRDLA
EQCVKVLELICTRESGAVFEAGGLNCVLTFIRDSGHLVHKDTLHSAMAVVSRLCGKMEPQ
DSSLEICVESLSSLLKHEDHQVSDGALRCFASLADRFTRRGVDPAPLAKHGLTEELLSRM
AAAGGTVSGPSSACKPGRSTTGAPSTTADSKLSNQVSTIVSLLSTLCRGSPVVTHDLLRS
ELPDSIESALQGDERCVLDTMRLVDLLLVLLFEGRKALPKSSAGSTGRIPGLRRLDSSGE
RSHRQLIDCIRSKDTDALIDAIDTGAFEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGA
DVNRGQRSSSLHYAACFGRPQVAKTLLRHGANPDLRDEDGKTPLDKARERGHSEVVAILQ
SPGDWMCPVNKGDDKKKKDTNKDEEECNEPKGDPEMAPIYLKRLLPVFAQTFQQTMLPSI
RKASLALIRKMIHFCSEALLKEVCDSDVGHNLPTILVEITATVLDQEDDDDGHLLALQII
RDLVDKGGDIFLDQLARLGVISKVSTLAGPSSDDENEEESKPEKEDEPQEDAKELQQGKP
YHWRDWSIIRGRDCLYIWSDAAALELSNGSNGWFRFILDGKLATMYSSGSPEGGSDSSES
RSEFLEKLQRARGQVKPSTSSQPILSAPGPTKLTVGNWSLTCLKEGEIAIHNSDGQQATI
LKEDLPGFVFESNRGTKHSFTAETSLGSEFVTGWTGKRGRKLKSKLEKTKQKVRTMARDL
YDDHFKAVESMPRGVVVTLRNIATQLESSWELHTNRQCIESENTWRDLMKTALENLIVLL
KDENTISPYEMCSSGLVQALLTVLNNSMDLDMKQDCSQLVERINVFKTAFSENEDDESRP
AVALIRKLIAVLESIERLPLHLYDTPGSTYNLQILTRRLRFRLERAPGETALIDRTGRML
KMEPLATVESLEQYLLKMVAKQWYDFDRSSFVFVRKLREGQNFIFRHQHDFDENGIIYWI
GTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLEDILSRDNSALNCHSNDDKNAWFAID
LGLWVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL
DPPKDEKQGWRHVRIKQMGKNASGQTHYLSLSGFELYGTVNGVCEDQLGKAAKEAEANLR
RQRRLVRSQVLKYMVPGARVIRGLDWKWRDQDGSPQGEGTVTGELHNGWIDVTWDAGGSN
SYRMGAEGKFDLKLAPGYDPDTVASPKPVSSTVSGTTQSWSSLVKNNCPDKTSAAAGSSS
RKGSSSSVCSVASSSDISLGSTKTERRSEIVMEHSIVSGADVHEPIVVLSSAENVPQTEV
GSSSSASTSTLTAETGSENAERKLGPDSSVRTPGESSAISMGIVSVSSPDVSSVSELTNK
EAASQRPLSSSASNRLSVSSLLAAGAPMSSSASVPNLSSRETSSLESFVRRVANIARTNA
TNNMNLSRSSSDNNTNTLGRNVMSTATSPLMGAQSFPNLTTPGTTSTVTMSTSSVTSSSN
VATATTVLSVGQSLSNTLTTSLTSTSSESDTGQEAEYSLYDFLDSCRASTLLAELDDDED
LPEPDEEDDENEDDNQEDQEYEEVMILRRPSLQRRAGSRSDVTHHAVTSQLPQVPAGAGS
RPIGEQEEEEYETKGGRRRTWDDDYVLKRQFSALVPAFDPRPGRTNVQQTTDLEIPPPGT
PHSELLEEVECTPSPRLALTLKVTGLGTTREVELPLTNFRSTIFYYVQKLLQLSCNGNVK
SDKLRRIWEPTYTIMYREMKDSDKEKENGKMGCWSIEHVEQYLGTDELPKNDLITYLQKN
ADAAFLRHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHGTKSGLNQGAISTLQSSDILNLT
KEQPQAKAGNGQNSCGVEDVLQLLRILYIVASDPYSRISQEDGDEQLQFTFPPDEFTSKK
ITTKILQQIEEPLALASGALPDWCEQLTSKCPFLIPFETRQLYFTCTAFGASRAIVWLQN
RREATVERTRTTSSVRRDDPGEFRVGRLKHERVKVPRGESLMEWAENVMQIHADRKSVLE
VEFLGEEGTGLGPTLEFYALVAAEFQRTDLGAWLCDDNFPDDESRHVDLGGGLKPPGYYV
QRSCGLFTAPFPQDSDELERITKLFHFLGIFLAKCIQDNRLVDLPISKPFFKLMCMGDIK
SNMSKLIYESRGDRDLHCTESQSEASTEEGHDSLSVGSFEEDSKSEFILDPPKPKPPAWF
NGILTWEDFELVNPHRARFLKEIKDLAIKRRQILSNKGLSEDEKNTKLQELVLKNPSGSG
PPLSIEDLGLNFQFCPSSRIYGFTAVDLKPSGEDEMITMDNAEEYVDLMFDFCMHTGIQK
QMEAFRDGFNKVFPMEKLSSFSHEEVQMILCGNQSPSWAAEDIINYTEPKLGYTRDSPGF
LRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCV
HYLKLPEYSSEEIMRERLLAATMEKGFHLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q69ZR2	0.705	0.703	0.000	2618	0.985	0.982	Q69ZR2.pdb.gz	HECD1_MOUSE E3 ubiquitin-protein ligase HECTD1 OS=Mus musculus OX=10090 GN=Hectd1 PE=1 SV=2
2	AFDB:V6CLA2	0.498	0.492	0.000	2648	0.396	0.390	V6CLA2.pdb.gz	HECD1_CAEEL E3 ubiquitin-protein ligase hecd-1 OS=Caenorhabditis elegans OX=6239 GN=hecd-1 PE=1 SV=1
3	AFDB:Q9P2P5	0.122	0.195	4.189E-13	1572	0.096	0.159	Q9P2P5.pdb.gz	HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens OX=9606 GN=HECW2 PE=1 SV=2
4	PDB:7jq9A	0.108	0.115	1.374E-7	2427	0.119	0.128	7jq9A.pdb.gz
5	PDB:7mopA	0.105	0.111	3.451E-7	2445	0.122	0.130	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
6	PDB:3tpoA	0.101	0.514	5.871E-7	438	0.030	0.176	3tpoA.pdb.gz
7	AFDB:Q5UIP0	0.091	0.095	1.345E-6	2472	0.087	0.091	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
8	PDB:5tbkA	0.112	0.544	1.760E-6	417	0.026	0.165	5tbkA.pdb.gz
9	AFDB:E1C2U2	0.088	0.098	1.850E-6	2326	0.087	0.097	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
10	AFDB:Q6PR54	0.092	0.099	2.933E-6	2419	0.079	0.085	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
11	PDB:1wa5B	0.117	0.521	5.278E-6	466	0.024	0.135	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
12	PDB:2z6gA	0.094	0.394	1.034E-5	550	0.030	0.144	2z6gA.pdb.gz
13	PDB:4r0zA	0.105	0.409	1.034E-5	557	0.027	0.126	4r0zA.pdb.gz
14	PDB:4tnmA	0.105	0.532	1.889E-5	407	0.028	0.182	4tnmA.pdb.gz
15	PDB:3w3zA	0.077	0.145	2.598E-5	1013	0.043	0.112	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
16	PDB:7rroH7	0.089	0.339	2.789E-5	580	0.031	0.141	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
17	AFDB:F4J8G7	0.061	0.068	3.757E-5	2138	0.092	0.112	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
18	AFDB:Q9VW47	0.066	0.067	2.730E-4	2531	0.079	0.082	Q9VW47.pdb.gz	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2
19	AFDB:Q0KK59	0.098	0.098	3.891E-4	2596	0.108	0.109	Q0KK59.pdb.gz	UNC79_MOUSE Protein unc-79 homolog OS=Mus musculus OX=10090 GN=Unc79 PE=1 SV=1
20	AFDB:P16157	0.062	0.081	6.618E-4	1881	0.095	0.131	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q69ZR2	0.0	5304	2618	0.986	0.983	HECD1_MOUSE E3 ubiquitin-protein ligase HECTD1 OS=Mus musculus OX=10090 GN=Hectd1 PE=1 SV=2
2	Q9ULT8	0.0	5398	2610	1.000	1.000	HECD1_HUMAN E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=4
3	Q9VL06	0.0	1694	2727	0.346	0.331	UFD4_DROME E3 ubiquitin-protein ligase Ufd4 OS=Drosophila melanogaster OX=7227 GN=Ufd4 PE=2 SV=1
4	V6CLA2	0.0	654	2648	0.130	0.128	HECD1_CAEEL E3 ubiquitin-protein ligase hecd-1 OS=Caenorhabditis elegans OX=6239 GN=hecd-1 PE=1 SV=1
5	V6CLA7	0.0	654	2650	0.130	0.128	V6CLA7_CAEEL E3 ubiquitin-protein ligase OS=Caenorhabditis elegans OX=6239 GN=hecd-1 PE=1 SV=1
6	Q6WWW4	2.05e-47	191	1888	0.040	0.056	UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis thaliana OX=3702 GN=UPL3 PE=1 SV=1
7	Q14669	8.44e-45	182	1992	0.038	0.050	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
8	G5E870	3.17e-43	177	2025	0.037	0.048	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
9	A0A0B4LHQ4	8.70e-38	159	2708	0.038	0.036	A0A0B4LHQ4_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
10	A0A0B4JCW5	8.72e-38	159	2929	0.038	0.033	A0A0B4JCW5_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
11	A0A0B4JCV6	8.73e-38	159	2930	0.038	0.033	A0A0B4JCV6_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
12	A0A0B4JD62	1.02e-37	159	2736	0.038	0.036	A0A0B4JD62_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
13	A0A0B4LGQ5	1.04e-37	159	2901	0.038	0.034	A0A0B4LGQ5_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
14	A0A0B4JDB5	1.05e-37	159	2737	0.038	0.036	A0A0B4JDB5_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
15	Q9VN58	1.06e-37	159	3140	0.038	0.031	Q9VN58_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=4
16	A0A0B4JDA1	1.08e-37	159	3139	0.038	0.031	A0A0B4JDA1_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
17	A0A0B4LGR2	1.13e-37	159	3111	0.038	0.032	A0A0B4LGR2_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
18	Q10435	1.20e-35	152	1647	0.032	0.050	YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC12B10.01c PE=3 SV=2
19	P33202	2.38e-35	151	1483	0.032	0.056	UFD4_YEAST Ubiquitin fusion degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UFD4 PE=1 SV=1
20	C0H4K6	3.92e-28	127	3893	0.028	0.019	C0H4K6_PLAF7 E3 ubiquitin-protein ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0704600 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.00023	32.7	Ankyrin repeat
2	PF12796 Ank_2	1.2e-14	66.0	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.00038	31.5	Ankyrin repeat
4	PF13637 Ank_4	0.00013	33.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.4e-06	39.7	Ankyrin repeats (many copies)
6	PF00514 Arm	93	14.5	Armadillo/beta-catenin-like repeat
7	PF18410 BTHB	3.7e-14	63.7	Basic tilted helix bundle domain
8	PF20509 DUF6735	35	15.6	Family of unknown function (DUF6735)
9	PF00754 F5_F8_type_C	0.045	25.3	F5/8 type C domain
10	PF00632 HECT	1.2e-69	246.8	HECT-domain (ubiquitin-transferase)
11	PF06701 MIB_HERC2	8.8e-20	81.9	Mib_herc2
12	PF07738 Sad1_UNC	4e-22	90.1	Sad1 / UNC-like C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000011807

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000017133	0.819	Ubiquitin protein ligase E3 component n-recognin 4
2	60711.ENSCSAP00000011157	0.809	Ubiquitin protein ligase E3 component n-recognin 3 (putative)
3	60711.ENSCSAP00000015563	0.807	SR-related CTD-associated factor 1
4	60711.ENSCSAP00000003303	0.801	Thyroid hormone receptor interactor 12
5	60711.ENSCSAP00000008147	0.791	Ubiquitin protein ligase E3 component n-recognin 5
6	60711.ENSCSAP00000007643	0.785	Ubiquitin protein ligase E3 component n-recognin 2
7	60711.ENSCSAP00000003426	0.681	Transcription elongation factor that enhances transcription elongation by RNA polymerase II (RNAPII).
8	60711.ENSCSAP00000005146	0.634	Ubiquitin protein ligase E3 component n-recognin 1
9	60711.ENSCSAP00000010696	0.602	Ubiquitin specific peptidase 34
10	60711.ENSCSAP00000009501	0.525	Polybromo 1
11	60711.ENSCSAP00000016227	0.512	Proteasome (prosome, macropain) subunit, beta type, 4
12	60711.ENSCSAP00000010261	0.511	Fetuin B
13	60711.ENSCSAP00000017063	0.510	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0070647	0.986	protein modification by small protein conjugation or removal
GO:0050794	0.985	regulation of cellular process
GO:0048519	0.956	negative regulation of biological process
GO:0048523	0.930	negative regulation of cellular process
GO:0048731	0.888	system development
GO:0009653	0.881	anatomical structure morphogenesis
GO:0035239	0.790	tube morphogenesis
GO:0048729	0.768	tissue morphogenesis
GO:0035148	0.762	tube formation
GO:0002009	0.757	morphogenesis of an epithelium
GO:0048513	0.753	animal organ development
GO:0032446	0.748	protein modification by small protein conjugation
GO:0009792	0.747	embryo development ending in birth or egg hatching
GO:0060606	0.733	tube closure
GO:0016567	0.731	protein ubiquitination
GO:0072359	0.727	circulatory system development
GO:0043009	0.692	chordate embryonic development
GO:0007399	0.688	nervous system development
GO:0060341	0.616	regulation of cellular localization
GO:0048598	0.609	embryonic morphogenesis
GO:0021915	0.603	neural tube development
GO:0001838	0.595	embryonic epithelial tube formation
GO:0001841	0.590	neural tube formation
GO:0014020	0.528	primary neural tube formation
GO:0048518	0.526	positive regulation of biological process
GO:0019222	0.495	regulation of metabolic process
GO:0030154	0.461	cell differentiation
GO:0048583	0.456	regulation of response to stimulus
GO:0007507	0.455	heart development
GO:0032880	0.453	regulation of protein localization
GO:0044237	0.445	cellular metabolic process
GO:0060255	0.431	regulation of macromolecule metabolic process
GO:0048522	0.418	positive regulation of cellular process
GO:0000209	0.414	protein polyubiquitination
GO:0080090	0.406	regulation of primary metabolic process
GO:0001944	0.406	vasculature development
GO:0003231	0.400	cardiac ventricle development
GO:0003170	0.395	heart valve development
GO:0051179	0.390	localization
GO:0051171	0.386	regulation of nitrogen compound metabolic process
GO:0003279	0.371	cardiac septum development
GO:0001568	0.370	blood vessel development
GO:0050896	0.365	response to stimulus
GO:0051641	0.365	cellular localization
GO:0031323	0.364	regulation of cellular metabolic process
GO:0008104	0.361	protein localization
GO:0003281	0.360	ventricular septum development
GO:0010646	0.352	regulation of cell communication
GO:0023051	0.351	regulation of signaling
GO:0001843	0.349	neural tube closure
GO:0048468	0.342	cell development
GO:0009893	0.309	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0016020	0.992	membrane
GO:0043226	0.990	organelle
GO:0043229	0.981	intracellular organelle
GO:0043231	0.967	intracellular membrane-bounded organelle
GO:0005829	0.965	cytosol
GO:0005654	0.936	nucleoplasm
GO:0032991	0.874	protein-containing complex
GO:1902494	0.354	catalytic complex
GO:0071944	0.317	cell periphery
GO:0005886	0.311	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]