StarFunc result for job id Q9ULU8

User Input

>input (1353 residues)
MLDPSSSEEESDEIVEEESGKEVLGSAPSGARLSPSRTSEGSAGSAGLGGGGAGAGAGVG
AGGGGGSGASSGGGAGGLQPSSRAGGGRPSSPSPSVVSEKEKEELERLQKEEEERKKRLQ
LYVFVMRCIAYPFNAKQPTDMARRQQKISKQQLQTVKDRFQAFLNGETQIMADEAFMNAV
QSYYEVFLKSDRVARMVQSGGCSANDSREVFKKHIEKRVRSLPEIDGLSKETVLSSWMAK
FDAIYRGEEDPRKQQARMTASAASELILSKEQLYEMFQNILGIKKFEHQLLYNACQLDNP
DEQAAQIRRELDGRLQMADQIARERKFPKFVSKEMENMYIEELKSSVNLLMANLESMPVS
KGGEFKLQKLKRSHNASIIDMGEESENQLSKSDVVLSFSLEVVIMEVQGLKSLAPNRIVY
CTMEVEGGEKLQTDQAEASKPTWGTQGDFSTTHALPAVKVKLFTESTGVLALEDKELGRV
ILHPTPNSPKQSEWHKMTVSKNCPDQDLKIKLAVRMDKPQNMKHSGYLWAIGKNVWKRWK
KRFFVLVQVSQYTFAMCSYREKKAEPQELLQLDGYTVDYTDPQPGLEGGRAFFNAVKEGD
TVIFASDDEQDRILWVQAMYRATGQSHKPVPPTQVQKLNAKGGNVPQLDAPISQFYADRA
QKHGMDEFISSNPCNFDHASLFEMVQRLTLDHRLNDSYSCLGWFSPGQVFVLDEYCARNG
VRGCHRHLCYLRDLLERAENGAMIDPTLLHYSFAFCASHVHGNRPDGIGTVTVEEKERFE
EIKERLRVLLENQITHFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPQEEVKTVIRK
CLEQAALVNYSRLSEYAKIEENQKDAENVGRLITPAKKLEDTIRLAELVIEVLQQNEEHH
AEPHVDKGEAFAWWSDLMVEHAETFLSLFAVDMDAALEVQPPDTWDSFPLFQLLNDFLRT
DYNLCNGKFHKHLQDLFAPLVVRYVDLMESSIAQSIHRGFERESWEPVKSLTSNLPNVNL
PNVNLPKVPNLPVNIPLGIPQMPTFSAPSWMAAIYDADNGSGTSEDLFWKLDALQTFIRD
LHWPEEEFGKHLEQRLKLMASDMIESCVKRTRIAFEVKLQKTSRSTDFRVPQSICTMFNV
MVDAKAQSTKLCSMEMGQEHQYHSKIDELIEETVKEMITLLVAKFVTILEGVLAKLSRYD
EGTLFSSFLSFTVKAASKYVDVPKPGMDVADAYVTFVRHSQDVLRDKVNEEMYIERLFDQ
WYNSSMNVICTWLTDRMDLQLHIYQLKTLIRMVKKTYRDFRLQGVLDSTLNSKTYETIRN
RLTVEEATASVSEGGGLQGISMKDSDEEDEEDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q23658	0.805	0.791	0.000	1378	0.488	0.479	Q23658.pdb.gz	CAPS_CAEEL Calcium-dependent secretion activator OS=Caenorhabditis elegans OX=6239 GN=unc-31 PE=2 SV=6
2	AFDB:Q62717	0.853	0.894	0.000	1289	0.936	0.982	Q62717.pdb.gz	CAPS1_RAT Calcium-dependent secretion activator 1 OS=Rattus norvegicus OX=10116 GN=Cadps PE=1 SV=1
3	AFDB:Q80TJ1	0.934	0.933	0.000	1355	0.988	0.987	Q80TJ1.pdb.gz	CAPS1_MOUSE Calcium-dependent secretion activator 1 OS=Mus musculus OX=10090 GN=Cadps PE=1 SV=3
4	AFDB:Q8BYR5	0.867	0.903	0.000	1297	0.754	0.786	Q8BYR5.pdb.gz	CAPS2_MOUSE Calcium-dependent secretion activator 2 OS=Mus musculus OX=10090 GN=Cadps2 PE=1 SV=2
5	AFDB:Q62768	0.289	0.234	7.669E-20	1735	0.124	0.097	Q62768.pdb.gz	UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus OX=10116 GN=Unc13a PE=1 SV=1
6	AFDB:Q1LUB2	0.091	0.108	2.848E-7	1089	0.062	0.077	Q1LUB2.pdb.gz
7	AFDB:Q9EPQ2	0.094	0.095	1.919E-5	1331	0.043	0.044	Q9EPQ2.pdb.gz	RPGR1_MOUSE X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 OS=Mus musculus OX=10090 GN=Rpgrip1 PE=1 SV=1
8	AFDB:Q54DS6	0.095	0.070	1.999E-5	2221	0.086	0.052	Q54DS6.pdb.gz	Q54DS6_DICDI SH3 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=docA PE=3 SV=1
9	AFDB:A1ZBD6	0.084	0.121	3.009E-5	912	0.025	0.037	A1ZBD6.pdb.gz	MCTP_DROME Multiple C2 and transmembrane domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Mctp PE=1 SV=3
10	PDB:5izrC	0.076	0.149	4.404E-5	659	0.021	0.042	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
11	AFDB:F1R3X3	0.089	0.117	4.717E-5	1010	0.051	0.068	F1R3X3.pdb.gz	F1R3X3_DANRE RAS p21 protein activator (GTPase-activating protein) 1a OS=Danio rerio OX=7955 GN=rasa1a PE=1 SV=2
12	PDB:5iz5B	0.080	0.141	5.402E-5	746	0.022	0.040	5iz5B.pdb.gz
13	PDB:1cjyA	0.080	0.164	6.904E-5	633	0.012	0.025	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
14	PDB:5ixcA	0.078	0.149	7.805E-5	684	0.021	0.042	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5iz5A	0.079	0.138	1.175E-4	757	0.022	0.040	5iz5A.pdb.gz
16	PDB:3ljuX	0.078	0.246	2.452E-4	373	0.024	0.086	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
17	PDB:7vciR	0.103	0.117	3.264E-4	1082	0.082	0.103	7vciR.pdb.gz
18	PDB:7r04B	0.085	0.063	3.844E-4	2229	0.073	0.044	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
19	PDB:7qpgR	0.084	0.071	7.097E-4	2208	0.083	0.051	7qpgR.pdb.gz
20	PDB:5a50A	0.075	0.525	8.358E-4	165	0.013	0.109	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RRN7	0.0	1602	776	0.572	0.997	A2RRN7_HUMAN CADPS protein OS=Homo sapiens OX=9606 GN=CADPS PE=1 SV=1
2	F8W8P5	0.0	1986	1194	0.705	0.799	F8W8P5_HUMAN Calcium dependent secretion activator 2 OS=Homo sapiens OX=9606 GN=CADPS2 PE=1 SV=2
3	H0Y8B5	0.0	775	490	0.269	0.743	H0Y8B5_HUMAN Calcium dependent secretion activator 2 (Fragment) OS=Homo sapiens OX=9606 GN=CADPS2 PE=1 SV=1
4	H9G2V2	0.0	1292	1385	0.476	0.465	H9G2V2_CAEEL Calcium-dependent secretion activator OS=Caenorhabditis elegans OX=6239 GN=unc-31 PE=1 SV=1
5	H9G2V3	0.0	1299	1366	0.475	0.471	H9G2V3_CAEEL Calcium-dependent secretion activator OS=Caenorhabditis elegans OX=6239 GN=unc-31 PE=1 SV=1
6	Q23658	0.0	1297	1378	0.475	0.467	CAPS_CAEEL Calcium-dependent secretion activator OS=Caenorhabditis elegans OX=6239 GN=unc-31 PE=2 SV=6
7	Q62717	0.0	2599	1289	0.936	0.983	CAPS1_RAT Calcium-dependent secretion activator 1 OS=Rattus norvegicus OX=10116 GN=Cadps PE=1 SV=1
8	Q80TJ1	0.0	2790	1355	0.990	0.989	CAPS1_MOUSE Calcium-dependent secretion activator 1 OS=Mus musculus OX=10090 GN=Cadps PE=1 SV=3
9	Q86UW7	0.0	2046	1296	0.726	0.758	CAPS2_HUMAN Calcium-dependent secretion activator 2 OS=Homo sapiens OX=9606 GN=CADPS2 PE=1 SV=2
10	Q8BYR5	0.0	2067	1297	0.732	0.764	CAPS2_MOUSE Calcium-dependent secretion activator 2 OS=Mus musculus OX=10090 GN=Cadps2 PE=1 SV=2
11	Q9NHE5	0.0	1500	1447	0.591	0.553	CAPS_DROME Calcium-dependent secretion activator OS=Drosophila melanogaster OX=7227 GN=Cadps PE=1 SV=3
12	Q9ULU8	0.0	2824	1353	1.000	1.000	CAPS1_HUMAN Calcium-dependent secretion activator 1 OS=Homo sapiens OX=9606 GN=CADPS PE=1 SV=3
13	G3MU01	4.16e-11	63.5	110	0.024	0.300	G3MU01_CAEEL Calcium-dependent secretion activator OS=Caenorhabditis elegans OX=6239 GN=unc-31 PE=4 SV=1
14	A2ADA6	0.008	43.1	829	0.022	0.036	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
15	Q3UH98	0.008	43.1	833	0.022	0.036	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
16	Q4QQN0	0.008	43.1	626	0.022	0.048	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
17	Q6NXL5	0.008	43.1	833	0.022	0.036	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
18	Q9UPW8	0.44	37.7	1703	0.050	0.040	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4
19	A0A0C4DGA6	0.61	37.0	1008	0.033	0.045	A0A0C4DGA6_HUMAN Helicase like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=1
20	Q966L9	0.64	37.0	974	0.017	0.024	GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans OX=6239 GN=glh-2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06292 MUN	1.5e-159	543.2	MUN domain
2	PF00169 PH	0.00014	33.7	PH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373215

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367756	0.874	Protein unc-13 homolog B
2	9606.ENSP00000474230	0.830	Ras-like protein family member 10B
3	9606.ENSP00000359337	0.789	Gamma-aminobutyric acid receptor subunit alpha-3
4	9606.ENSP00000357869	0.770	Phosphatidylinositol 4-kinase beta
5	9606.ENSP00000361475	0.769	Neuronal calcium sensor 1
6	9606.ENSP00000429562	0.742	Protein unc-13 homolog A
7	9606.ENSP00000378687	0.732	Nuclear envelope pore membrane protein POM 121
8	9606.ENSP00000362399	0.719	Syntaxin-binding protein 1
9	9606.ENSP00000384719	0.695	Visinin-like protein 1
10	9606.ENSP00000254976	0.681	Synaptosomal-associated protein 25
11	9606.ENSP00000265969	0.667	Potassium voltage-gated channel subfamily C member 1
12	9606.ENSP00000218176	0.650	Potassium voltage-gated channel subfamily D member 1
13	9606.ENSP00000440984	0.650	AP-3 complex subunit beta-2
14	9606.ENSP00000295718	0.647	Receptor-type tyrosine-protein phosphatase-like N
15	9606.ENSP00000374036	0.644	Rabphilin-3A
16	9606.ENSP00000333496	0.630	Potassium voltage-gated channel subfamily D member 2
17	9606.ENSP00000368278	0.623	Interleukin-1 receptor accessory protein-like 1
18	9606.ENSP00000247026	0.615	Nuclear speckle splicing regulatory protein 1
19	9606.ENSP00000332773	0.613	Immunoglobulin superfamily DCC subclass member 3
20	9606.ENSP00000334375	0.609	Leucine rich repeats and calponin homology domain containing 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0065007	0.978	biological regulation
GO:0006887	0.975	exocytosis
GO:0050794	0.865	regulation of cellular process
GO:0045055	0.732	regulated exocytosis
GO:0023052	0.725	signaling
GO:0007154	0.721	cell communication
GO:0007267	0.641	cell-cell signaling
GO:0065008	0.521	regulation of biological quality
GO:0051641	0.486	cellular localization
GO:0099537	0.460	trans-synaptic signaling
GO:0071840	0.407	cellular component organization or biogenesis
GO:0007268	0.401	chemical synaptic transmission
GO:0016043	0.365	cellular component organization
GO:0048518	0.359	positive regulation of biological process
GO:0051049	0.335	regulation of transport
GO:0048522	0.334	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0045202	0.993	synapse
GO:0005829	0.988	cytosol
GO:0031410	0.916	cytoplasmic vesicle
GO:0016020	0.878	membrane
GO:0071944	0.662	cell periphery
GO:0098978	0.461	glutamatergic synapse
GO:0005886	0.423	plasma membrane
GO:0012505	0.416	endomembrane system
GO:0005634	0.402	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]