StarFunc result for job id Q9ULV1

User Input

>input (537 residues)
MAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGM
CLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
CHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLT
FLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QZH0	0.753	0.752	2.309E-77	538	0.972	0.970	Q9QZH0.pdb.gz	FZD4_RAT Frizzled-4 OS=Rattus norvegicus OX=10116 GN=Fzd4 PE=2 SV=1
2	AFDB:Q8K4C8	0.603	0.548	4.521E-49	592	0.518	0.470	Q8K4C8.pdb.gz	FZD9_RAT Frizzled-9 OS=Rattus norvegicus OX=10116 GN=Fzd9 PE=2 SV=1
3	AFDB:Q90WM3	0.608	0.564	9.828E-49	580	0.521	0.483	Q90WM3.pdb.gz
4	AFDB:Q8BKG4	0.621	0.574	1.950E-48	582	0.516	0.476	Q8BKG4.pdb.gz	FZD10_MOUSE Frizzled-10 OS=Mus musculus OX=10090 GN=Fzd10 PE=1 SV=1
5	AFDB:Q9PTT7	0.591	0.550	8.800E-43	579	0.453	0.420	Q9PTT7.pdb.gz
6	AFDB:O93274	0.605	0.561	1.009E-42	581	0.439	0.406	O93274.pdb.gz	FZD8_XENLA Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 SV=1
7	AFDB:P58421	0.584	0.562	1.009E-42	559	0.445	0.428	P58421.pdb.gz	FZD5_XENLA Frizzled-5 OS=Xenopus laevis OX=8355 GN=fzd5 PE=2 SV=1
8	AFDB:B0S6S2	0.593	0.555	1.390E-42	576	0.438	0.408	B0S6S2.pdb.gz
9	AFDB:B3DIG4	0.572	0.520	1.454E-42	592	0.443	0.402	B3DIG4.pdb.gz	B3DIG4_DANRE Frizzled class receptor 5 OS=Danio rerio OX=7955 GN=fzd8c PE=2 SV=1
10	AFDB:O75084	0.574	0.538	8.639E-42	574	0.462	0.432	O75084.pdb.gz	FZD7_HUMAN Frizzled-7 OS=Homo sapiens OX=9606 GN=FZD7 PE=1 SV=2
11	PDB:7evwR	0.536	0.831	2.875E-24	340	0.328	0.518	7evwR.pdb.gz
12	PDB:7e32R	0.360	0.615	2.160E-6	285	0.086	0.161	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
13	PDB:6wwzR	0.374	0.586	1.471E-5	310	0.060	0.103	6wwzR.pdb.gz
14	PDB:7f1qR	0.376	0.516	1.471E-5	367	0.058	0.084	7f1qR.pdb.gz
15	PDB:7rkfR	0.361	0.583	2.220E-5	296	0.052	0.095	7rkfR.pdb.gz	Atypical structural snapshots of human cytomegalovirus GPCR interactions with host G proteins
16	PDB:7wicR	0.396	0.681	2.220E-5	288	0.065	0.122	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
17	PDB:7d3sR	0.347	0.632	2.789E-5	266	0.073	0.147	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
18	PDB:7wq3R	0.391	0.675	3.505E-5	289	0.067	0.125	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
19	PDB:7jvrR	0.403	0.739	4.020E-5	269	0.048	0.097	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
20	PDB:7fiiR	0.388	0.368	4.208E-5	570	0.063	0.060	7fiiR.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00144	0.0	540	591	0.501	0.455	FZD9_HUMAN Frizzled-9 OS=Homo sapiens OX=9606 GN=FZD9 PE=2 SV=1
2	Q61088	0.0	1082	537	0.970	0.970	FZD4_MOUSE Frizzled-4 OS=Mus musculus OX=10090 GN=Fzd4 PE=1 SV=1
3	Q8BKG4	0.0	545	582	0.523	0.483	FZD10_MOUSE Frizzled-10 OS=Mus musculus OX=10090 GN=Fzd10 PE=1 SV=1
4	Q8K4C8	0.0	548	592	0.507	0.459	FZD9_RAT Frizzled-9 OS=Rattus norvegicus OX=10116 GN=Fzd9 PE=2 SV=1
5	Q8TAN2	0.0	538	591	0.497	0.452	Q8TAN2_HUMAN Frizzled homolog 9 (Drosophila) OS=Homo sapiens OX=9606 GN=FZD9 PE=1 SV=1
6	Q9QZH0	0.0	1078	538	0.974	0.972	FZD4_RAT Frizzled-4 OS=Rattus norvegicus OX=10116 GN=Fzd4 PE=2 SV=1
7	Q9R216	0.0	548	592	0.507	0.459	FZD9_MOUSE Frizzled-9 OS=Mus musculus OX=10090 GN=Fzd9 PE=2 SV=1
8	Q9ULV1	0.0	1111	537	1.000	1.000	FZD4_HUMAN Frizzled-4 OS=Homo sapiens OX=9606 GN=FZD4 PE=1 SV=2
9	Q9ULW2	0.0	544	581	0.505	0.466	FZD10_HUMAN Frizzled-10 OS=Homo sapiens OX=9606 GN=FZD10 PE=1 SV=1
10	Q9W6E3	0.0	556	580	0.523	0.484	Q9W6E3_DANRE Frizzled class receptor 10 OS=Danio rerio OX=7955 GN=fk48e04 PE=2 SV=1
11	Q9YI00	1.54e-158	466	579	0.453	0.420	Q9YI00_DANRE Frizzled 8a protein OS=Danio rerio OX=7955 GN=zg05 PE=2 SV=1
12	Q90YL7	1.61e-154	454	550	0.467	0.456	Q90YL7_DANRE Frizzled homolog 2 OS=Danio rerio OX=7955 GN=zfz2 PE=2 SV=1
13	Q9PWK6	1.68e-151	447	576	0.441	0.411	Q9PWK6_DANRE Frizzled 8b protein OS=Danio rerio OX=7955 GN=ZG06 PE=2 SV=1
14	Q8QFM3	1.77e-151	447	557	0.447	0.431	Q8QFM3_DANRE Frizzled 7a OS=Danio rerio OX=7955 GN=fz7b PE=1 SV=1
15	P58421	3.21e-151	446	559	0.443	0.426	FZD5_XENLA Frizzled-5 OS=Xenopus laevis OX=8355 GN=fzd5 PE=2 SV=1
16	B3DIG4	5.28e-151	447	592	0.438	0.397	B3DIG4_DANRE Frizzled class receptor 5 OS=Danio rerio OX=7955 GN=fzd8c PE=2 SV=1
17	Q14332	6.38e-150	443	565	0.453	0.430	FZD2_HUMAN Frizzled-2 OS=Homo sapiens OX=9606 GN=FZD2 PE=1 SV=1
18	Q6NV44	1.30e-149	442	559	0.434	0.417	Q6NV44_DANRE Frizzled class receptor 7a OS=Danio rerio OX=7955 GN=fzd7a PE=2 SV=2
19	Q9PUK8	6.07e-149	440	549	0.451	0.441	FZD7A_XENLA Frizzled-7-A OS=Xenopus laevis OX=8355 GN=fzd7-a PE=1 SV=2
20	O93274	7.46e-149	441	581	0.419	0.387	FZD8_XENLA Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09129 Chol_subst-bind	1.7e+02	12.6	Cholesterol oxidase, substrate-binding
2	PF01534 Frizzled	2.2e-121	416.6	Frizzled/Smoothened family membrane region
3	PF01392 Fz	1.5e-26	104.6	Fz domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000434034

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264634	0.999	Protein Wnt-5a
2	9606.ENSP00000294304	0.999	Low-density lipoprotein receptor-related protein 5
3	9606.ENSP00000367301	0.999	Norrin
4	9606.ENSP00000261349	0.991	Low-density lipoprotein receptor-related protein 6
5	9606.ENSP00000005340	0.976	Segment polarity protein dishevelled homolog DVL-2
6	9606.ENSP00000265441	0.965	Protein Wnt-2
7	9606.ENSP00000222747	0.960	Tetraspanin-12
8	9606.ENSP00000364860	0.960	Tyrosine-protein kinase transmembrane receptor ROR2
9	9606.ENSP00000368169	0.953	Segment polarity protein dishevelled homolog DVL-1
10	9606.ENSP00000284523	0.951	Protein Wnt-3a
11	9606.ENSP00000304604	0.939	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3
12	9606.ENSP00000358698	0.937	Protein Wnt-2b
13	9606.ENSP00000293549	0.935	Proto-oncogene Wnt-1
14	9606.ENSP00000379721	0.919	Ubiquitin carboxyl-terminal hydrolase 8
15	9606.ENSP00000351605	0.914	Frizzled-6
16	9606.ENSP00000219255	0.912	Partitioning defective 6 homolog alpha
17	9606.ENSP00000341032	0.912	Protein Wnt-7b
18	9606.ENSP00000285018	0.911	Protein Wnt-7a
19	9606.ENSP00000363826	0.911	Frizzled-8
20	9606.ENSP00000437489	0.911	Frizzled-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017147	1.000	Wnt-protein binding
GO:0004888	1.000	transmembrane signaling receptor activity
GO:0042813	0.983	Wnt receptor activity
GO:0019955	0.680	cytokine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.996	signal transduction
GO:0032501	0.987	multicellular organismal process
GO:0007267	0.987	cell-cell signaling
GO:0048518	0.983	positive regulation of biological process
GO:0016055	0.961	Wnt signaling pathway
GO:0032502	0.960	developmental process
GO:0048522	0.960	positive regulation of cellular process
GO:0048856	0.921	anatomical structure development
GO:0031323	0.914	regulation of cellular metabolic process
GO:0060070	0.900	canonical Wnt signaling pathway
GO:0060255	0.860	regulation of macromolecule metabolic process
GO:0010604	0.839	positive regulation of macromolecule metabolic process
GO:0051171	0.833	regulation of nitrogen compound metabolic process
GO:0065009	0.823	regulation of molecular function
GO:0051173	0.821	positive regulation of nitrogen compound metabolic process
GO:0080090	0.820	regulation of primary metabolic process
GO:0007275	0.758	multicellular organism development
GO:0048519	0.754	negative regulation of biological process
GO:0022603	0.722	regulation of anatomical structure morphogenesis
GO:0048731	0.683	system development
GO:0051128	0.674	regulation of cellular component organization
GO:0048583	0.588	regulation of response to stimulus
GO:0048523	0.538	negative regulation of cellular process
GO:0010468	0.528	regulation of gene expression
GO:0031325	0.528	positive regulation of cellular metabolic process
GO:0048513	0.527	animal organ development
GO:0009966	0.470	regulation of signal transduction
GO:0010556	0.461	regulation of macromolecule biosynthetic process
GO:0051252	0.455	regulation of RNA metabolic process
GO:0006355	0.452	regulation of DNA-templated transcription
GO:0009653	0.424	anatomical structure morphogenesis
GO:0048584	0.387	positive regulation of response to stimulus
GO:0044093	0.338	positive regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005622	0.938	intracellular anatomical structure
GO:0043226	0.917	organelle
GO:0043227	0.907	membrane-bounded organelle
GO:0005737	0.868	cytoplasm
GO:0043229	0.829	intracellular organelle
GO:0043231	0.695	intracellular membrane-bounded organelle
GO:0030659	0.477	cytoplasmic vesicle membrane
GO:0030139	0.361	endocytic vesicle
GO:0098588	0.348	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]