StarFunc result for job id Q9ULV3

User Input

>input (898 residues)
MFSQQQQQQLQQQQQQLQQLQQQQLQQQQLQQQQLLQLQQLLQQSPPQAPLPMAVSRGLP
PQQPQQPLLNLQGTNSASLLNGSMLQRALLLQQLQGLDQFAMPPATYDTAGLTMPTATLG
NLRGYGMASPGLAAPSLTPPQLATPNLQQFFPQATRQSLLGPPPVGVPMNPSQFNLSGRN
PQKQARTSSSTTPNRKDSSSQTMPVEDKSDPPEGSEEAAEPRMDTPEDQDLPPCPEDIAK
EKRTPAPEPEPCEASELPAKRLRSSEEPTEKEPPGQLQVKAQPQARMTVPKQTQTPDLLP
EALEAQVLPRFQPRVLQVQAQVQSQTQPRIPSTDTQVQPKLQKQAQTQTSPEHLVLQQKQ
VQPQLQQEAEPQKQVQPQVQPQAHSQGPRQVQLQQEAEPLKQVQPQVQPQAHSQPPRQVQ
LQLQKQVQTQTYPQVHTQAQPSVQPQEHPPAQVSVQPPEQTHEQPHTQPQVSLLAPEQTP
VVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPG
VWGAGGSLKVTILQSSDSRAFSTVPLTPVPRPSDSVSSTPAATSTPSKQALQFFCYICKA
SCSSQQEFQDHMSEPQHQQRLGEIQHMSQACLLSLLPVPRDVLETEDEEPPPRRWCNTCQ
LYYMGDLIQHRRTQDHKIAKQSLRPFCTVCNRYFKTPRKFVEHVKSQGHKDKAKELKSLE
KEIAGQDEDHFITVDAVGCFEGDEEEEEDDEDEEEIEVEEELCKQVRSRDISREEWKGSE
TYSPNTAYGVDFLVPVMGYICRICHKFYHSNSGAQLSHCKSLGHFENLQKYKAAKNPSPT
TRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKVTARPSQPPLPRRSTRLKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R885	0.258	0.258	0.000	898	1.000	1.000	A0A024R885.pdb.gz
2	AFDB:F5H2X7	0.121	0.115	0.000	954	0.998	0.939	F5H2X7.pdb.gz	F5H2X7_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=2
3	AFDB:Q5SYW2	0.198	0.203	0.000	870	0.968	0.999	Q5SYW2.pdb.gz	Q5SYW2_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
4	AFDB:A0A494C0L7	0.171	0.182	3.483E-104	820	0.911	0.998	A0A494C0L7.pdb.gz	A0A494C0L7_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
5	AFDB:Q8VEH2	0.316	0.332	2.005E-74	845	0.665	0.707	Q8VEH2.pdb.gz	Q8VEH2_MOUSE CDKN1A interacting zinc finger protein 1 OS=Mus musculus OX=10090 GN=Ciz1 PE=1 SV=1
6	AFDB:Q3TXU6	0.170	0.185	1.342E-73	800	0.644	0.723	Q3TXU6.pdb.gz	Q3TXU6_MOUSE Matrin-type domain-containing protein OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1
7	AFDB:Q9VI93	0.056	0.054	3.030E-6	946	0.131	0.125	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
8	AFDB:Q24206	0.042	0.043	5.420E-5	880	0.121	0.124	Q24206.pdb.gz	BRC4_DROME Broad-complex core protein isoform 6 OS=Drosophila melanogaster OX=7227 GN=br PE=1 SV=2
9	AFDB:Q9HCE3	0.054	0.044	1.044E-4	1301	0.147	0.101	Q9HCE3.pdb.gz	ZN532_HUMAN Zinc finger protein 532 OS=Homo sapiens OX=9606 GN=ZNF532 PE=1 SV=2
10	AFDB:B8A5T9	0.054	0.053	1.115E-4	927	0.156	0.151	B8A5T9.pdb.gz
11	PDB:6qx91C	0.043	0.687	2.544E-1	50	0.011	0.200	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:7v3vI	0.059	0.112	7.261E-1	328	0.032	0.088	7v3vI.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
13	PDB:7o4iW	0.027	0.064	2.213	312	0.032	0.093	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	PDB:3w5kB	0.043	0.218	2.693	110	0.024	0.200	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
15	PDB:1b8tA	0.036	0.110	2.876	192	0.028	0.130	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
16	PDB:7abgA	0.040	0.020	2.876	2174	0.026	0.011	7abgA.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
17	PDB:7mqaNA	0.031	0.082	2.876	295	0.038	0.115	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:6bk8O	0.038	0.099	3.501	229	0.024	0.096	6bk8O.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
19	PDB:6hivDH	0.056	0.075	3.501	564	0.029	0.046	6hivDH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	PDB:6n7pB	0.048	0.201	3.991	195	0.031	0.144	6n7pB.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C0L7	0.0	1604	820	0.906	0.993	A0A494C0L7_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
2	A2AN61	0.0	884	821	0.588	0.643	A2AN61_MOUSE CDKN1A interacting zinc finger protein 1 OS=Mus musculus OX=10090 GN=Ciz1 PE=1 SV=1
3	F5H2X7	0.0	1781	954	1.000	0.941	F5H2X7_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=2
4	H0Y5D5	0.0	1637	820	0.913	1.000	H0Y5D5_HUMAN CDKN1A interacting zinc finger protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
5	Q3TMV1	0.0	620	796	0.386	0.436	Q3TMV1_MOUSE Matrin-type domain-containing protein OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1
6	Q3TXU6	0.0	623	800	0.386	0.434	Q3TXU6_MOUSE Matrin-type domain-containing protein OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1
7	Q3UUV0	0.0	617	791	0.385	0.437	Q3UUV0_MOUSE CDKN1A interacting zinc finger protein 1 OS=Mus musculus OX=10090 GN=Ciz1 PE=1 SV=1
8	Q5SYW2	0.0	1705	870	0.957	0.987	Q5SYW2_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
9	Q70KX6	0.0	616	708	0.385	0.489	Q70KX6_MOUSE Cip1-interacting zinc-finger protein OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1
10	Q8VEH2	0.0	942	845	0.618	0.657	Q8VEH2_MOUSE CDKN1A interacting zinc finger protein 1 OS=Mus musculus OX=10090 GN=Ciz1 PE=1 SV=1
11	Q9BTG3	0.0	1655	837	0.931	0.999	Q9BTG3_HUMAN CIZ1 protein OS=Homo sapiens OX=9606 PE=1 SV=1
12	Q9ULV3	0.0	1796	898	1.000	1.000	CIZ1_HUMAN Cip1-interacting zinc finger protein OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=2
13	Q8BIT2	8.01e-177	530	719	0.321	0.401	Q8BIT2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1
14	F6VD24	2.26e-165	483	252	0.281	1.000	F6VD24_HUMAN CDKN1A interacting zinc finger protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
15	Q6GQU3	5.49e-113	358	547	0.254	0.417	Q6GQU3_MOUSE Ciz1 protein OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1
16	F7AT58	3.52e-112	345	235	0.197	0.753	F7AT58_MOUSE CDKN1A interacting zinc finger protein 1 (Fragment) OS=Mus musculus OX=10090 GN=Ciz1 PE=1 SV=1
17	F6XWQ4	3.51e-93	297	288	0.209	0.653	F6XWQ4_MOUSE CDKN1A interacting zinc finger protein 1 (Fragment) OS=Mus musculus OX=10090 GN=Ciz1 PE=1 SV=1
18	Q9CUW6	6.40e-78	253	206	0.164	0.714	Q9CUW6_MOUSE Matrin-type domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1
19	F7BM53	1.25e-71	237	226	0.159	0.633	F7BM53_MOUSE CDKN1A interacting zinc finger protein 1 (Fragment) OS=Mus musculus OX=10090 GN=Ciz1 PE=1 SV=1
20	F7D5G9	4.40e-61	209	245	0.169	0.620	F7D5G9_MOUSE CDKN1A interacting zinc finger protein 1 (Fragment) OS=Mus musculus OX=10090 GN=Ciz1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12756 zf-C2H2_2	12	17.7	C2H2 type zinc-finger (2 copies)
2	PF13894 zf-C2H2_4	2.7e+02	13.8	C2H2-type zinc finger
3	PF12171 zf-C2H2_jaz	0.0089	27.5	Zinc-finger double-stranded RNA-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000439244

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384849	0.984	Cyclin-dependent kinase inhibitor 1
2	9606.ENSP00000209728	0.833	Cell division control protein 6 homolog
3	9606.ENSP00000255465	0.828	Cyclin-A1
4	9606.ENSP00000256737	0.804	Anoctamin-3
5	9606.ENSP00000451080	0.778	Enhancer of rudimentary homolog
6	9606.ENSP00000254250	0.767	THAP domain-containing protein 1
7	9606.ENSP00000334051	0.755	Guanine nucleotide-binding protein G(olf) subunit alpha
8	9606.ENSP00000397927	0.754	Polymerase delta-interacting protein 3
9	9606.ENSP00000300504	0.742	TBC1 domain family member 21
10	9606.ENSP00000480987	0.740	DNA replication licensing factor MCM3
11	9606.ENSP00000377080	0.722	Zinc finger protein 1 homolog
12	9606.ENSP00000300784	0.707	Fructosamine-3-kinase
13	9606.ENSP00000274026	0.699	Cyclin-A2
14	9606.ENSP00000345719	0.689	Torsin-1A
15	9606.ENSP00000385510	0.678	G-protein-signaling modulator 2
16	9606.ENSP00000467423	0.674	Scaffold attachment factor B1
17	9606.ENSP00000215829	0.666	Small nuclear ribonucleoprotein Sm D3
18	9606.ENSP00000468057	0.664	Heat shock protein beta-6
19	9606.ENSP00000269373	0.642	Ketosamine-3-kinase
20	9606.ENSP00000365439	0.641	Heterogeneous nuclear ribonucleoprotein K

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030332	1.000	cyclin binding
GO:0046872	0.997	metal ion binding
GO:0008270	0.991	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.996	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0048522	0.879	positive regulation of cellular process
GO:0019222	0.858	regulation of metabolic process
GO:0031323	0.844	regulation of cellular metabolic process
GO:0060255	0.843	regulation of macromolecule metabolic process
GO:0080090	0.839	regulation of primary metabolic process
GO:0051171	0.838	regulation of nitrogen compound metabolic process
GO:0051173	0.811	positive regulation of nitrogen compound metabolic process
GO:0031325	0.805	positive regulation of cellular metabolic process
GO:0010604	0.800	positive regulation of macromolecule metabolic process
GO:0051179	0.772	localization
GO:0045935	0.761	positive regulation of nucleobase-containing compound metabolic process
GO:0051052	0.750	regulation of DNA metabolic process
GO:0034504	0.736	protein localization to nucleus
GO:0072595	0.716	maintenance of protein localization in organelle
GO:2000105	0.715	positive regulation of DNA-templated DNA replication
GO:0030174	0.714	regulation of DNA-templated DNA replication initiation
GO:0051457	0.714	maintenance of protein location in nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005886	0.995	plasma membrane
GO:0005737	0.537	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]