StarFunc result for job id Q9ULV4

User Input

>input (474 residues)
MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLV
LPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLT
EPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNV
SWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRM
SERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESP
YVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERKCEPIIMTVPRKSDLFQDD
LYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKC
DLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULV4	1.000	1.000	2.393E-97	474	1.000	1.000	Q9ULV4.pdb.gz	COR1C_HUMAN Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1
2	AFDB:B0R0D7	0.875	0.875	3.363E-85	474	0.812	0.812	B0R0D7.pdb.gz	COR1C_DANRE Coronin-1C-A OS=Danio rerio OX=7955 GN=coro1ca PE=2 SV=1
3	AFDB:Q9BR76	0.826	0.800	1.366E-80	489	0.738	0.716	Q9BR76.pdb.gz	COR1B_HUMAN Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1
4	AFDB:Q6QEF8	0.884	0.888	1.320E-78	472	0.686	0.689	Q6QEF8.pdb.gz	CORO6_HUMAN Coronin-6 OS=Homo sapiens OX=9606 GN=CORO6 PE=1 SV=2
5	PDB:7styA	0.814	0.989	2.784E-78	390	0.823	1.000	7styA.pdb.gz
6	AFDB:Q7SX58	0.824	0.858	3.284E-74	455	0.641	0.668	Q7SX58.pdb.gz	Q7SX58_DANRE Coronin OS=Danio rerio OX=7955 GN=fj83g12 PE=1 SV=1
7	AFDB:G8G223	0.851	0.874	2.651E-71	461	0.624	0.642	G8G223.pdb.gz	G8G223_PIG Coronin OS=Sus scrofa OX=9823 GN=coro1a PE=3 SV=1
8	AFDB:A0A0B4KEJ7	0.843	0.748	8.062E-66	535	0.561	0.497	A0A0B4KEJ7.pdb.gz	A0A0B4KEJ7_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
9	AFDB:Q8BH44	0.816	0.806	4.808E-58	480	0.449	0.444	Q8BH44.pdb.gz	COR2B_MOUSE Coronin-2B OS=Mus musculus OX=10090 GN=Coro2b PE=1 SV=2
10	AFDB:P27133	0.811	0.864	7.306E-57	445	0.401	0.427	P27133.pdb.gz	COROA_DICDI Coronin-A OS=Dictyostelium discoideum OX=44689 GN=corA PE=1 SV=2
11	AFDB:Q92828	0.815	0.738	2.055E-56	525	0.428	0.387	Q92828.pdb.gz	COR2A_HUMAN Coronin-2A OS=Homo sapiens OX=9606 GN=CORO2A PE=1 SV=2
12	PDB:5nnzA	0.479	0.652	4.149E-15	335	0.129	0.182	5nnzA.pdb.gz
13	PDB:2h9lA	0.505	0.720	9.909E-15	321	0.124	0.184	2h9lA.pdb.gz
14	PDB:5mzhB	0.491	0.553	1.531E-14	415	0.122	0.140	5mzhB.pdb.gz
15	PDB:3jcmB	0.522	0.573	1.803E-14	429	0.120	0.133	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
16	PDB:5yzgs	0.343	0.416	2.242E-14	374	0.101	0.128	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
17	PDB:3w15A	0.469	0.640	5.970E-14	336	0.103	0.146	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
18	PDB:7ajtUO	0.487	0.470	7.028E-14	493	0.105	0.101	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:7bt6x	0.441	0.430	8.275E-14	488	0.118	0.115	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
20	PDB:7uwfA	0.475	0.611	8.738E-14	361	0.084	0.111	7uwfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KEJ7	0.0	537	535	0.555	0.492	A0A0B4KEJ7_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
2	A0A0B4KEU5	0.0	536	534	0.555	0.493	A0A0B4KEU5_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
3	B0R0D7	0.0	845	474	0.812	0.812	COR1C_DANRE Coronin-1C-A OS=Danio rerio OX=7955 GN=coro1ca PE=2 SV=1
4	G8G223	0.0	653	461	0.637	0.655	G8G223_PIG Coronin OS=Sus scrofa OX=9823 GN=coro1a PE=3 SV=1
5	O89046	0.0	767	484	0.736	0.721	COR1B_RAT Coronin-1B OS=Rattus norvegicus OX=10116 GN=Coro1b PE=1 SV=1
6	O89053	0.0	659	461	0.646	0.664	COR1A_MOUSE Coronin-1A OS=Mus musculus OX=10090 GN=Coro1a PE=1 SV=5
7	P31146	0.0	660	461	0.641	0.659	COR1A_HUMAN Coronin-1A OS=Homo sapiens OX=9606 GN=CORO1A PE=1 SV=4
8	Q6QEF8	0.0	720	472	0.686	0.689	CORO6_HUMAN Coronin-6 OS=Homo sapiens OX=9606 GN=CORO6 PE=1 SV=2
9	Q7JVY0	0.0	543	528	0.555	0.498	Q7JVY0_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
10	Q7SX58	0.0	667	455	0.639	0.666	Q7SX58_DANRE Coronin OS=Danio rerio OX=7955 GN=fj83g12 PE=1 SV=1
11	Q9BR76	0.0	768	489	0.738	0.716	COR1B_HUMAN Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1
12	Q9ULV4	0.0	989	474	1.000	1.000	COR1C_HUMAN Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1
13	Q9WUM3	0.0	774	484	0.738	0.723	COR1B_MOUSE Coronin-1B OS=Mus musculus OX=10090 GN=Coro1b PE=1 SV=1
14	Q9WUM4	0.0	965	474	0.975	0.975	COR1C_MOUSE Coronin-1C OS=Mus musculus OX=10090 GN=Coro1c PE=1 SV=2
15	Q9UQ03	5.46e-145	425	480	0.454	0.448	COR2B_HUMAN Coronin-2B OS=Homo sapiens OX=9606 GN=CORO2B PE=1 SV=4
16	Q8BH44	1.82e-144	424	480	0.451	0.446	COR2B_MOUSE Coronin-2B OS=Mus musculus OX=10090 GN=Coro2b PE=1 SV=2
17	Q92828	2.18e-141	417	525	0.411	0.371	COR2A_HUMAN Coronin-2A OS=Homo sapiens OX=9606 GN=CORO2A PE=1 SV=2
18	Q8C0P5	1.21e-136	405	524	0.395	0.357	COR2A_MOUSE Coronin-2A OS=Mus musculus OX=10090 GN=Coro2a PE=2 SV=1
19	P27133	6.80e-132	390	445	0.382	0.407	COROA_DICDI Coronin-A OS=Dictyostelium discoideum OX=44689 GN=corA PE=1 SV=2
20	O13923	7.13e-115	352	601	0.390	0.308	CORO_SCHPO Coronin-like protein crn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=crn1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.0038	28.8	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08953 DUF1899	2.9e-28	108.9	Domain of unknown function (DUF1899)
3	PF08662 eIF2A	12	17.2	Eukaryotic translation initiation factor eIF2A
4	PF09445 Methyltransf_15	5e+02	11.7	RNA cap guanine-N2 methyltransferase
5	PF18548 MetOD2	4.9e+02	12.2	Metanogen output domain 2
6	PF20426 NBCH_WD40	0.062	23.7	Neurobeachin beta propeller domain
7	PF00400 WD40	3.3e-11	54.7	WD domain, G-beta repeat
8	PF16300 WD40_4	4.6e-21	85.7	Type of WD40 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000015172

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000010895	0.867	ARP2 actin-related protein 2 homolog (yeast)
2	60711.ENSCSAP00000014283	0.714	Uncharacterized protein
3	60711.ENSCSAP00000007826	0.694	RAB27A, member RAS oncogene family
4	60711.ENSCSAP00000004865	0.660	Coronin, actin binding protein, 1B
5	60711.ENSCSAP00000011787	0.634	Myosin IG
6	60711.ENSCSAP00000001615	0.618	AKT interacting protein
7	60711.ENSCSAP00000008961	0.558	Triple QxxK/R motif containing
8	60711.ENSCSAP00000012890	0.558	Chromosome 4 open reading frame 19
9	60711.ENSCSAP00000014594	0.546	Dual specificity phosphatase 3
10	60711.ENSCSAP00000009145	0.545	Zinc finger protein 639
11	60711.ENSCSAP00000007637	0.543	Ataxin 7-like 1
12	60711.ENSCSAP00000014775	0.538	Fibrinogen beta chain
13	60711.ENSCSAP00000013696	0.533	Belongs to the actin family.
14	60711.ENSCSAP00000006204	0.532	annotation not available
15	60711.ENSCSAP00000006224	0.532	annotation not available
16	60711.ENSCSAP00000003789	0.528	TBC1 domain family, member 7
17	60711.ENSCSAP00000007569	0.527	Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 2
18	60711.ENSCSAP00000018096	0.522	RNA binding motif protein 12B
19	60711.ENSCSAP00000013200	0.519	threonyl-tRNA synthetase
20	60711.ENSCSAP00000013784	0.512	Lymphocyte cytosolic protein 1 (L-plastin)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.998	cytoskeletal protein binding
GO:0044877	0.997	protein-containing complex binding
GO:0003779	0.977	actin binding
GO:0051015	0.968	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0009987	0.986	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0016043	0.955	cellular component organization
GO:0051128	0.943	regulation of cellular component organization
GO:0065009	0.910	regulation of molecular function
GO:0006996	0.908	organelle organization
GO:0032502	0.890	developmental process
GO:0040012	0.874	regulation of locomotion
GO:0031344	0.859	regulation of cell projection organization
GO:0048856	0.858	anatomical structure development
GO:0032501	0.850	multicellular organismal process
GO:0048518	0.840	positive regulation of biological process
GO:0030029	0.821	actin filament-based process
GO:0048519	0.791	negative regulation of biological process
GO:0048523	0.783	negative regulation of cellular process
GO:0007420	0.779	brain development
GO:0044087	0.766	regulation of cellular component biogenesis
GO:0048522	0.749	positive regulation of cellular process
GO:0051179	0.731	localization
GO:0007010	0.728	cytoskeleton organization
GO:0051641	0.651	cellular localization
GO:0050896	0.649	response to stimulus
GO:0043087	0.638	regulation of GTPase activity
GO:0044093	0.598	positive regulation of molecular function
GO:0051234	0.596	establishment of localization
GO:0006810	0.580	transport
GO:0019222	0.574	regulation of metabolic process
GO:0043085	0.561	positive regulation of catalytic activity
GO:2000145	0.545	regulation of cell motility
GO:0051130	0.544	positive regulation of cellular component organization
GO:0051129	0.535	negative regulation of cellular component organization
GO:0030334	0.515	regulation of cell migration
GO:0120035	0.514	regulation of plasma membrane bounded cell projection organization
GO:0040013	0.508	negative regulation of locomotion
GO:0016192	0.506	vesicle-mediated transport
GO:0048870	0.495	cell motility
GO:0016477	0.427	cell migration
GO:0030155	0.403	regulation of cell adhesion
GO:0031346	0.396	positive regulation of cell projection organization
GO:0031323	0.393	regulation of cellular metabolic process
GO:0001667	0.382	ameboidal-type cell migration
GO:0048869	0.366	cellular developmental process
GO:0030154	0.356	cell differentiation
GO:0048762	0.343	mesenchymal cell differentiation
GO:0060255	0.325	regulation of macromolecule metabolic process
GO:0048468	0.319	cell development
GO:0048863	0.317	stem cell differentiation
GO:0022607	0.307	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043227	0.999	membrane-bounded organelle
GO:0005856	0.997	cytoskeleton
GO:0016020	0.996	membrane
GO:0032991	0.995	protein-containing complex
GO:0071944	0.991	cell periphery
GO:0015629	0.980	actin cytoskeleton
GO:0005925	0.972	focal adhesion
GO:0031982	0.971	vesicle
GO:0005576	0.967	extracellular region
GO:0042995	0.965	cell projection
GO:0120025	0.962	plasma membrane bounded cell projection
GO:0005886	0.955	plasma membrane
GO:0005829	0.941	cytosol
GO:0043231	0.936	intracellular membrane-bounded organelle
GO:0005615	0.933	extracellular space
GO:0070062	0.915	extracellular exosome
GO:0031252	0.859	cell leading edge
GO:0012505	0.649	endomembrane system
GO:0030027	0.380	lamellipodium
GO:0005938	0.346	cell cortex
GO:0097708	0.321	intracellular vesicle
GO:0005634	0.312	nucleus
GO:0099512	0.305	supramolecular fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]