StarFunc result for job id Q9ULV8

User Input

>input (474 residues)
MALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAH
SRRAAGGGGPGGPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFRAGSRLRRQ
LAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLG
TCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMA
FLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLE
GQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFELCKICAESNKD
VKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQE
GRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULV8	1.000	1.000	4.532E-84	474	1.000	1.000	Q9ULV8.pdb.gz	CBLC_HUMAN E3 ubiquitin-protein ligase CBL-C OS=Homo sapiens OX=9606 GN=CBLC PE=1 SV=3
2	AFDB:P22682	0.762	0.402	6.084E-45	913	0.462	0.240	P22682.pdb.gz	CBL_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cbl PE=1 SV=3
3	AFDB:Q13191	0.764	0.375	1.015E-44	982	0.437	0.211	Q13191.pdb.gz	CBLB_HUMAN E3 ubiquitin-protein ligase CBL-B OS=Homo sapiens OX=9606 GN=CBLB PE=1 SV=2
4	AFDB:A0A0U1RR39	0.610	0.344	1.609E-44	862	0.456	0.251	A0A0U1RR39.pdb.gz	A0A0U1RR39_HUMAN E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=1
5	AFDB:B9EKI5	0.605	0.313	2.826E-44	938	0.445	0.225	B9EKI5.pdb.gz	B9EKI5_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cblb PE=1 SV=1
6	AFDB:F1QI90	0.753	0.398	3.295E-44	913	0.468	0.243	F1QI90.pdb.gz
7	AFDB:Q98TY6	0.609	0.326	7.101E-44	903	0.454	0.238	Q98TY6.pdb.gz	Q98TY6_CHICK E3 ubiquitin-protein ligase CBL OS=Gallus gallus OX=9031 PE=2 SV=1
8	AFDB:Q9VSK2	0.766	0.419	1.977E-43	878	0.414	0.223	Q9VSK2.pdb.gz	Q9VSK2_DROME E3 ubiquitin-protein ligase CBL OS=Drosophila melanogaster OX=7227 GN=Cbl PE=2 SV=2
9	AFDB:A0A0U1ZFN5	0.609	0.347	9.703E-39	846	0.435	0.243	A0A0U1ZFN5.pdb.gz	A0A0U1ZFN5_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
10	AFDB:Q19019	0.763	0.627	8.330E-38	582	0.392	0.320	Q19019.pdb.gz	Q19019_CAEEL E3 ubiquitin-protein ligase CBL OS=Caenorhabditis elegans OX=6239 GN=sli-1 PE=1 SV=1
11	PDB:5xzrA	0.131	0.121	2.928E-2	519	0.049	0.044	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
12	PDB:4gwfA	0.138	0.132	4.190E-2	497	0.023	0.022	4gwfA.pdb.gz
13	PDB:3ps5A	0.134	0.121	8.150E-2	529	0.049	0.043	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
14	PDB:3qwyA	0.106	0.277	8.150E-2	170	0.021	0.059	3qwyA.pdb.gz
15	PDB:4k2rA	0.124	0.108	1.000E-1	551	0.034	0.029	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
16	PDB:4fl2A	0.105	0.090	1.053E-1	555	0.023	0.020	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
17	PDB:1griA	0.115	0.247	1.431E-1	211	0.019	0.043	1griA.pdb.gz
18	PDB:5dkaA	0.092	0.418	1.586E-1	96	0.034	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
19	PDB:4r8pL	0.103	0.181	1.669E-1	254	0.051	0.094	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
20	PDB:1ka6A	0.117	0.458	2.048E-1	107	0.023	0.103	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ULV8	0.0	972	474	1.000	1.000	CBLC_HUMAN E3 ubiquitin-protein ligase CBL-C OS=Homo sapiens OX=9606 GN=CBLC PE=1 SV=3
2	Q5U376	4.50e-142	432	913	0.424	0.220	Q5U376_DANRE E3 ubiquitin-protein ligase CBL OS=Danio rerio OX=7955 GN=wu:fd16a12 PE=2 SV=1
3	A0A8I6AFF7	2.91e-141	427	825	0.418	0.240	A0A8I6AFF7_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
4	A0A8I6G861	3.32e-141	428	870	0.418	0.228	A0A8I6G861_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
5	P22682	4.08e-141	429	913	0.418	0.217	CBL_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cbl PE=1 SV=3
6	D3ZV15	4.88e-141	428	894	0.418	0.221	D3ZV15_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=2
7	A0A8I6G3R2	5.65e-141	429	914	0.418	0.217	A0A8I6G3R2_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
8	A0A0U1RR39	5.98e-141	427	862	0.416	0.229	A0A0U1RR39_HUMAN E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=1
9	P22681	1.53e-140	427	906	0.416	0.217	CBL_HUMAN E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2
10	Q98TY6	2.33e-140	427	903	0.416	0.218	Q98TY6_CHICK E3 ubiquitin-protein ligase CBL OS=Gallus gallus OX=9031 PE=2 SV=1
11	Q8K4S7	5.05e-138	422	938	0.420	0.212	CBLB_RAT E3 ubiquitin-protein ligase CBL-B OS=Rattus norvegicus OX=10116 GN=Cblb PE=1 SV=1
12	B9EKI5	6.32e-138	421	938	0.420	0.212	B9EKI5_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cblb PE=1 SV=1
13	Q3TTA7	1.32e-137	422	982	0.420	0.203	CBLB_MOUSE E3 ubiquitin-protein ligase CBL-B OS=Mus musculus OX=10090 GN=Cblb PE=1 SV=3
14	Q13191	1.63e-137	422	982	0.420	0.203	CBLB_HUMAN E3 ubiquitin-protein ligase CBL-B OS=Homo sapiens OX=9606 GN=CBLB PE=1 SV=2
15	O46034	4.04e-134	396	448	0.399	0.422	O46034_DROME E3 ubiquitin-protein ligase CBL OS=Drosophila melanogaster OX=7227 GN=Cbl PE=2 SV=1
16	P91683	1.44e-133	395	448	0.397	0.420	P91683_DROME E3 ubiquitin-protein ligase CBL OS=Drosophila melanogaster OX=7227 GN=Cbl PE=2 SV=1
17	A0A8I5ZWU2	7.04e-131	399	802	0.392	0.232	A0A8I5ZWU2_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
18	Q9VSK2	4.75e-130	399	878	0.401	0.216	Q9VSK2_DROME E3 ubiquitin-protein ligase CBL OS=Drosophila melanogaster OX=7227 GN=Cbl PE=2 SV=2
19	A0A0U1ZFN5	1.07e-129	397	846	0.388	0.217	A0A0U1ZFN5_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
20	Q6ABG8	5.27e-113	345	523	0.392	0.356	Q6ABG8_CAEEL E3 ubiquitin-protein ligase CBL OS=Caenorhabditis elegans OX=6239 GN=sli-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02262 Cbl_N	2.8e-39	145.3	CBL proto-oncogene N-terminal domain 1
2	PF02761 Cbl_N2	7.4e-31	117.9	CBL proto-oncogene N-terminus, EF hand-like domain
3	PF02762 Cbl_N3	1.9e-38	141.5	CBL proto-oncogene N-terminus, SH2-like domain
4	PF14447 Prok-RING_4	3.8e-08	44.4	Prokaryotic RING finger family 4
5	PF00017 SH2	2.7e+02	13.0	SH2 domain
6	PF00097 zf-C3HC4	0.03	25.5	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	4.8	18.4	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	4.7e-05	34.4	Zinc finger, C3HC4 type (RING finger)
9	PF13639 zf-RING_2	0.024	26.3	Ring finger domain
10	PF14634 zf-RING_5	1.2e+02	14.1	zinc-RING finger domain
11	PF13445 zf-RING_UBOX	47	15.4	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000270279

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.994	Epidermal growth factor receptor
2	9606.ENSP00000362680	0.966	Proto-oncogene tyrosine-protein kinase Src
3	9606.ENSP00000346671	0.902	Tyrosine-protein kinase Fyn
4	9606.ENSP00000380921	0.873	SH3 domain-containing kinase-binding protein 1
5	9606.ENSP00000462468	0.864	Tyrosine-protein kinase Yes
6	9606.ENSP00000264122	0.838	E3 ubiquitin-protein ligase CBL-B
7	9606.ENSP00000264033	0.832	E3 ubiquitin-protein ligase CBL
8	9606.ENSP00000320092	0.828	Endophilin-A3
9	9606.ENSP00000269886	0.821	Endophilin-A2
10	9606.ENSP00000369981	0.821	Endophilin-A1
11	9606.ENSP00000361634	0.807	Endophilin-B2
12	9606.ENSP00000300574	0.799	Adapter molecule crk
13	9606.ENSP00000268035	0.706	Insulin-like growth factor 1 receptor
14	9606.ENSP00000292408	0.698	Fibroblast growth factor receptor 4
15	9606.ENSP00000339824	0.656	Fibroblast growth factor receptor 3
16	9606.ENSP00000410294	0.653	Fibroblast growth factor receptor 2
17	9606.ENSP00000257290	0.637	Platelet-derived growth factor receptor alpha
18	9606.ENSP00000378332	0.592	Transforming growth factor beta-1-induced transcript 1 protein
19	9606.ENSP00000381717	0.589	Ubiquitin-conjugating enzyme E2 D2
20	9606.ENSP00000347942	0.579	Proto-oncogene tyrosine-protein kinase receptor Ret

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061630	0.998	ubiquitin protein ligase activity
GO:0005102	0.996	signaling receptor binding
GO:0001784	0.987	phosphotyrosine residue binding
GO:0019904	0.985	protein domain specific binding
GO:0005154	0.985	epidermal growth factor receptor binding
GO:0017124	0.983	SH3 domain binding
GO:0008270	0.982	zinc ion binding
GO:0019899	0.852	enzyme binding
GO:0019900	0.382	kinase binding
GO:0019901	0.369	protein kinase binding
GO:1990782	0.358	protein tyrosine kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0071704	0.973	organic substance metabolic process
GO:0048519	0.969	negative regulation of biological process
GO:0019222	0.963	regulation of metabolic process
GO:0044238	0.953	primary metabolic process
GO:0006807	0.945	nitrogen compound metabolic process
GO:0048523	0.937	negative regulation of cellular process
GO:0044237	0.927	cellular metabolic process
GO:1901564	0.926	organonitrogen compound metabolic process
GO:0019538	0.918	protein metabolic process
GO:0048583	0.915	regulation of response to stimulus
GO:0060255	0.906	regulation of macromolecule metabolic process
GO:0036211	0.894	protein modification process
GO:0051338	0.880	regulation of transferase activity
GO:0050730	0.875	regulation of peptidyl-tyrosine phosphorylation
GO:0043549	0.872	regulation of kinase activity
GO:0009966	0.868	regulation of signal transduction
GO:0051248	0.855	negative regulation of protein metabolic process
GO:0045859	0.843	regulation of protein kinase activity
GO:1901185	0.834	negative regulation of ERBB signaling pathway
GO:0043408	0.826	regulation of MAPK cascade
GO:0031400	0.820	negative regulation of protein modification process
GO:0006508	0.812	proteolysis
GO:0042326	0.806	negative regulation of phosphorylation
GO:0001933	0.792	negative regulation of protein phosphorylation
GO:0051348	0.763	negative regulation of transferase activity
GO:0071900	0.741	regulation of protein serine/threonine kinase activity
GO:0050896	0.733	response to stimulus
GO:0043632	0.731	modification-dependent macromolecule catabolic process
GO:0007154	0.726	cell communication
GO:0048518	0.721	positive regulation of biological process
GO:0048522	0.688	positive regulation of cellular process
GO:0043405	0.679	regulation of MAP kinase activity
GO:0042058	0.677	regulation of epidermal growth factor receptor signaling pathway
GO:0006511	0.664	ubiquitin-dependent protein catabolic process
GO:0051716	0.650	cellular response to stimulus
GO:0016567	0.624	protein ubiquitination
GO:0007165	0.608	signal transduction
GO:0061097	0.601	regulation of protein tyrosine kinase activity
GO:0050732	0.582	negative regulation of peptidyl-tyrosine phosphorylation
GO:0010469	0.549	regulation of signaling receptor activity
GO:0006469	0.549	negative regulation of protein kinase activity
GO:0043409	0.426	negative regulation of MAPK cascade
GO:0007166	0.422	cell surface receptor signaling pathway
GO:0071901	0.313	negative regulation of protein serine/threonine kinase activity
GO:0042059	0.308	negative regulation of epidermal growth factor receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0016020	0.983	membrane
GO:0005829	0.964	cytosol
GO:0071944	0.956	cell periphery
GO:0005886	0.942	plasma membrane
GO:0043229	0.548	intracellular organelle
GO:0043227	0.544	membrane-bounded organelle
GO:0043231	0.523	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]