StarFunc result for job id Q9ULW0

User Input

>input (747 residues)
MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTP
LRKANLQQAIVTPLKPVDNTYYKEAEKENLVEQSIPSNACSSLEVEAAISRKTPAQPQRR
SLRLSAQKDLEQKEKHHVKMKAKRCATPVIIDEILPSKKMKVSNNKKKPEEEGSAHQDTA
EKNASSPEKAKGRHTVPCMPPAKQKFLKSTEEQELEKSMKMQQEVVEMRKKNEEFKKLAL
AGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKG
CTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKDDINLLPSKSSV
TKICRDPQTPVLQTKHRARAVTCKSTAELEAEELEKLQQYKFKARELDPRILEGGPILPK
KPPVKPPTEPIGFDLEIEKRIQERESKKKTEDEHFEFHSRPCPTKILEDVVGVPEKKVLP
ITVPKSPAFALKNRIRMPTKEDEEEDEPVVIKAQPVPHYGVPFKPQIPEARTVEICPFSF
DSRDKERQLQKEKKIKELQKGEVPKFKALPLPHFDTINLPEKKVKNVTQIEPFCLETDRR
GALKAQTWKHQLEEELRQQKEAACFKARPNTVISQEPFVPKKEKKSVAEGLSGSLVQEPF
QLATEKRAKERQELEKRMAEVEAQKAQQLEEARLQEEEQKKEELARLRRELVHKANPIRK
YQGLEIKSSDQPLTVPVSPKFSTRFHC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q643R0	0.264	0.264	5.176E-101	747	1.000	1.000	Q643R0.pdb.gz	Q643R0_HUMAN HCTP4 OS=Homo sapiens OX=9606 GN=HCTP4 PE=2 SV=1
2	AFDB:A2APB8	0.207	0.207	9.923E-87	745	0.791	0.793	A2APB8.pdb.gz	TPX2_MOUSE Targeting protein for Xklp2 OS=Mus musculus OX=10090 GN=Tpx2 PE=1 SV=1
3	AFDB:F4I2H7	0.110	0.105	4.459E-11	790	0.202	0.191	F4I2H7.pdb.gz	TPX2_ARATH Protein TPX2 OS=Arabidopsis thaliana OX=3702 GN=TPX2 PE=1 SV=1
4	AFDB:Q54RP6	0.049	0.024	1.778E-4	1709	0.107	0.047	Q54RP6.pdb.gz	DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum OX=44689 GN=dhkL PE=3 SV=1
5	AFDB:P17564	0.058	0.064	1.355E-3	657	0.155	0.177	P17564.pdb.gz	PR15A_MOUSE Protein phosphatase 1 regulatory subunit 15A OS=Mus musculus OX=10090 GN=Ppp1r15a PE=1 SV=1
6	AFDB:Q6IN02	0.038	0.046	2.609E-3	578	0.112	0.145	Q6IN02.pdb.gz	PR15A_RAT Protein phosphatase 1 regulatory subunit 15A OS=Rattus norvegicus OX=10116 GN=Ppp1r15a PE=2 SV=2
7	AFDB:Q9VKL0	0.072	0.057	3.391E-3	968	0.123	0.095	Q9VKL0.pdb.gz	Q9VKL0_DROME SAM-motif ubiquitously expressed punctatedly localized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Samuel PE=4 SV=2
8	AFDB:P40563	0.056	0.061	6.528E-3	679	0.141	0.155	P40563.pdb.gz	AIM21_YEAST Altered inheritance of mitochondria protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIM21 PE=1 SV=1
9	AFDB:E1JIP0	0.052	0.054	1.530E-2	717	0.096	0.100	E1JIP0.pdb.gz	E1JIP0_DROME FI18283p1 OS=Drosophila melanogaster OX=7227 GN=sr PE=2 SV=1
10	AFDB:P34333	0.064	0.029	1.634E-2	1778	0.099	0.042	P34333.pdb.gz	NCOR1_CAEEL Nuclear receptor corepressor 1 OS=Caenorhabditis elegans OX=6239 GN=gei-8 PE=1 SV=4
11	PDB:6n8jb	0.038	0.049	1.079	647	0.058	0.066	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
12	PDB:6v92R	0.064	0.126	2.368	325	0.062	0.142	6v92R.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
13	PDB:5ganG	0.045	0.089	3.286	318	0.044	0.104	5ganG.pdb.gz	Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
14	PDB:7sqkE	0.069	0.083	3.286	610	0.040	0.049	7sqkE.pdb.gz
15	PDB:6tdaS	0.063	0.061	3.746	783	0.044	0.042	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
16	PDB:6lss4	0.051	0.059	7.701	620	0.071	0.085	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
17	PDB:3ghgI	0.062	0.101	9.374	394	0.035	0.066	3ghgI.pdb.gz	Crystal structure of human fibrinogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2APB8	0.0	1138	745	0.791	0.793	TPX2_MOUSE Targeting protein for Xklp2 OS=Mus musculus OX=10090 GN=Tpx2 PE=1 SV=1
2	Q643R0	0.0	1515	747	1.000	1.000	Q643R0_HUMAN HCTP4 OS=Homo sapiens OX=9606 GN=HCTP4 PE=2 SV=1
3	Q9ULW0	0.0	1515	747	1.000	1.000	TPX2_HUMAN Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2
4	F4I2H7	4.40e-05	49.3	790	0.146	0.138	TPX2_ARATH Protein TPX2 OS=Arabidopsis thaliana OX=3702 GN=TPX2 PE=1 SV=1
5	Q5XVC4	1.77e-04	47.4	488	0.071	0.109	MDP60_ARATH Microtubule-destabilizing protein 60 OS=Arabidopsis thaliana OX=3702 GN=MDP60 PE=2 SV=1
6	Q8JI03	0.14	36.2	145	0.021	0.110	Q8JI03_DANRE Siaz-interacting nuclear protein OS=Danio rerio OX=7955 GN=zgc:66284 PE=2 SV=1
7	Q4V3B0	0.15	37.7	501	0.041	0.062	Q4V3B0_ARATH At4g11990 OS=Arabidopsis thaliana OX=3702 GN=TPXL2 PE=1 SV=1
8	Q9SJ62	1.5	34.7	432	0.040	0.069	WDL4_ARATH Protein WVD2-like 4 OS=Arabidopsis thaliana OX=3702 GN=WDL4 PE=1 SV=2
9	F4IK85	4.5	33.1	700	0.033	0.036	F4IK85_ARATH Kinase with adenine nucleotide alpha hydrolases-like domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At2g07020 PE=1 SV=1
10	F4K773	4.5	32.0	178	0.046	0.191	F4K773_ARATH TPX2 (Targeting protein for Xklp2) protein family OS=Arabidopsis thaliana OX=3702 GN=At5g37478 PE=1 SV=1
11	Q84ZT9	6.7	32.0	202	0.046	0.168	WVD2_ARATH Protein WAVE-DAMPENED 2 OS=Arabidopsis thaliana OX=3702 GN=WVD2 PE=2 SV=1
12	Q6AY14	8.8	32.0	474	0.024	0.038	F161A_RAT Protein FAM161A OS=Rattus norvegicus OX=10116 GN=Fam161a PE=2 SV=2
13	Q8GYX9	8.9	31.6	286	0.029	0.077	WDL1_ARATH Protein WVD2-like 1 OS=Arabidopsis thaliana OX=3702 GN=WDL1 PE=1 SV=1
14	Q8IGP7	9.0	32.3	781	0.029	0.028	Q8IGP7_DROME RE52507p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Incenp PE=2 SV=1
15	A0A0B4LFQ2	9.1	32.3	754	0.029	0.029	A0A0B4LFQ2_DROME Inner centromere protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Incenp PE=1 SV=1
16	Q7JRJ9	9.3	32.0	755	0.029	0.029	Q7JRJ9_DROME Inner centromere protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Incenp PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09041 Aurora-A_bind	1.3e-36	135.7	Aurora-A binding
2	PF06886 TPX2	1.1e-14	65.5	Targeting protein for Xklp2 (TPX2) domain
3	PF12214 TPX2_importin	2.2e-38	143.5	Cell cycle regulated microtubule associated protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300403

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216911	0.999	Aurora kinase A
2	9606.ENSP00000324020	0.999	Kinesin-like protein KIF15
3	9606.ENSP00000260731	0.997	Kinesin-like protein KIF11
4	9606.ENSP00000411532	0.997	DNA topoisomerase 2-alpha
5	9606.ENSP00000247191	0.996	Disks large-associated protein 5
6	9606.ENSP00000300093	0.994	Serine/threonine-protein kinase PLK1
7	9606.ENSP00000438483	0.994	Importin subunit alpha-1
8	9606.ENSP00000302530	0.988	Mitotic checkpoint serine/threonine-protein kinase BUB1
9	9606.ENSP00000377793	0.988	Protein regulator of cytokinesis 1
10	9606.ENSP00000313950	0.985	Aurora kinase B
11	9606.ENSP00000378356	0.985	Kinesin-like protein KIF20A
12	9606.ENSP00000363524	0.983	Chromosome-associated kinesin KIF4A
13	9606.ENSP00000356379	0.981	Abnormal spindle-like microcephaly-associated protein
14	9606.ENSP00000361298	0.981	Kinesin-like protein KIF2C
15	9606.ENSP00000348838	0.979	Ubiquitin-conjugating enzyme E2 C
16	9606.ENSP00000377492	0.979	Hyaluronan mediated motility receptor
17	9606.ENSP00000256442	0.973	G2/mitotic-specific cyclin-B1
18	9606.ENSP00000361540	0.973	Cell division cycle protein 20 homolog
19	9606.ENSP00000251496	0.971	Condensin complex subunit 3
20	9606.ENSP00000298048	0.970	Maternal embryonic leucine zipper kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061676	1.000	importin-alpha family protein binding
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0071840	0.927	cellular component organization or biogenesis
GO:0007049	0.926	cell cycle
GO:0016043	0.921	cellular component organization
GO:0022402	0.919	cell cycle process
GO:0048519	0.914	negative regulation of biological process
GO:1903047	0.891	mitotic cell cycle process
GO:0048518	0.889	positive regulation of biological process
GO:0048522	0.879	positive regulation of cellular process
GO:0060255	0.867	regulation of macromolecule metabolic process
GO:0051171	0.867	regulation of nitrogen compound metabolic process
GO:0080090	0.863	regulation of primary metabolic process
GO:0031323	0.857	regulation of cellular metabolic process
GO:0006996	0.841	organelle organization
GO:0140014	0.832	mitotic nuclear division
GO:0051128	0.831	regulation of cellular component organization
GO:0048523	0.819	negative regulation of cellular process
GO:0000070	0.815	mitotic sister chromatid segregation
GO:0033043	0.812	regulation of organelle organization
GO:0007051	0.803	spindle organization
GO:0022607	0.792	cellular component assembly
GO:0007052	0.788	mitotic spindle organization
GO:0070507	0.770	regulation of microtubule cytoskeleton organization
GO:0090307	0.767	mitotic spindle assembly
GO:0043244	0.715	regulation of protein-containing complex disassembly
GO:0051173	0.687	positive regulation of nitrogen compound metabolic process
GO:0051129	0.685	negative regulation of cellular component organization
GO:0010604	0.681	positive regulation of macromolecule metabolic process
GO:0031325	0.672	positive regulation of cellular metabolic process
GO:0010564	0.664	regulation of cell cycle process
GO:0031110	0.627	regulation of microtubule polymerization or depolymerization
GO:1902903	0.615	regulation of supramolecular fiber organization
GO:0065009	0.589	regulation of molecular function
GO:0043242	0.565	negative regulation of protein-containing complex disassembly
GO:0051347	0.545	positive regulation of transferase activity
GO:0031401	0.512	positive regulation of protein modification process
GO:0019220	0.486	regulation of phosphate metabolic process
GO:0010639	0.463	negative regulation of organelle organization
GO:0033674	0.442	positive regulation of kinase activity
GO:0031109	0.432	microtubule polymerization or depolymerization
GO:1901879	0.405	regulation of protein depolymerization
GO:0001932	0.387	regulation of protein phosphorylation
GO:0051494	0.378	negative regulation of cytoskeleton organization
GO:0065003	0.376	protein-containing complex assembly
GO:1902904	0.376	negative regulation of supramolecular fiber organization
GO:0031114	0.374	regulation of microtubule depolymerization
GO:0045860	0.363	positive regulation of protein kinase activity
GO:0007026	0.349	negative regulation of microtubule depolymerization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005819	1.000	spindle
GO:0005654	0.999	nucleoplasm
GO:0005737	0.997	cytoplasm
GO:0005829	0.992	cytosol
GO:0045171	0.791	intercellular bridge
GO:0072686	0.787	mitotic spindle
GO:0032991	0.578	protein-containing complex
GO:0000922	0.418	spindle pole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]