StarFunc result for job id Q9ULW2

User Input

>input (581 residues)
MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEH
PLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFF
SSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHK
CKMNNQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVCSRRLK
KKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQSPTCV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BKG4	0.671	0.670	4.385E-82	582	0.929	0.928	Q8BKG4.pdb.gz	FZD10_MOUSE Frizzled-10 OS=Mus musculus OX=10090 GN=Fzd10 PE=1 SV=1
2	AFDB:Q90WM3	0.626	0.627	1.383E-69	580	0.754	0.755	Q90WM3.pdb.gz
3	AFDB:Q8K4C8	0.613	0.602	3.573E-61	592	0.635	0.623	Q8K4C8.pdb.gz	FZD9_RAT Frizzled-9 OS=Rattus norvegicus OX=10116 GN=Fzd9 PE=2 SV=1
4	AFDB:Q9QZH0	0.593	0.638	1.344E-47	538	0.484	0.522	Q9QZH0.pdb.gz	FZD4_RAT Frizzled-4 OS=Rattus norvegicus OX=10116 GN=Fzd4 PE=2 SV=1
5	AFDB:Q9PTT7	0.532	0.534	7.287E-46	579	0.435	0.437	Q9PTT7.pdb.gz
6	AFDB:B0S6S2	0.565	0.570	7.629E-46	576	0.434	0.438	B0S6S2.pdb.gz
7	AFDB:B3DIG4	0.536	0.527	1.665E-45	592	0.423	0.416	B3DIG4.pdb.gz	B3DIG4_DANRE Frizzled class receptor 5 OS=Danio rerio OX=7955 GN=fzd8c PE=2 SV=1
8	AFDB:O93274	0.546	0.546	2.094E-45	581	0.437	0.437	O93274.pdb.gz	FZD8_XENLA Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 SV=1
9	AFDB:O75084	0.546	0.553	5.749E-45	574	0.453	0.458	O75084.pdb.gz	FZD7_HUMAN Frizzled-7 OS=Homo sapiens OX=9606 GN=FZD7 PE=1 SV=2
10	AFDB:Q13467	0.544	0.541	7.927E-45	585	0.444	0.441	Q13467.pdb.gz	FZD5_HUMAN Frizzled-5 OS=Homo sapiens OX=9606 GN=FZD5 PE=1 SV=2
11	PDB:7evwR	0.502	0.841	2.860E-24	340	0.312	0.532	7evwR.pdb.gz
12	PDB:7e32R	0.326	0.594	5.969E-6	285	0.086	0.175	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
13	PDB:6wwzR	0.363	0.610	4.103E-5	310	0.057	0.106	6wwzR.pdb.gz
14	PDB:7jvrR	0.361	0.707	5.404E-5	269	0.048	0.104	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
15	PDB:5w0pC	0.372	0.266	5.658E-5	850	0.067	0.046	5w0pC.pdb.gz
16	PDB:7rkfR	0.316	0.544	8.953E-5	296	0.076	0.149	7rkfR.pdb.gz	Atypical structural snapshots of human cytomegalovirus GPCR interactions with host G proteins
17	PDB:7xw5R	0.368	0.373	1.076E-4	572	0.076	0.077	7xw5R.pdb.gz	Hormone- and antibody-mediated activation of the thyrotropin receptor.
18	PDB:7d3sR	0.272	0.524	1.417E-4	266	0.088	0.192	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
19	PDB:6pt0R	0.332	0.582	1.553E-4	298	0.074	0.144	6pt0R.pdb.gz	Cryo-EM Structure of the Human Cannabinoid Receptor CB2-GiSignaling Complex.
20	PDB:7wq3R	0.352	0.647	1.626E-4	289	0.046	0.093	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00144	0.0	739	591	0.625	0.614	FZD9_HUMAN Frizzled-9 OS=Homo sapiens OX=9606 GN=FZD9 PE=2 SV=1
2	Q61088	0.0	549	537	0.473	0.512	FZD4_MOUSE Frizzled-4 OS=Mus musculus OX=10090 GN=Fzd4 PE=1 SV=1
3	Q8BKG4	0.0	1142	582	0.929	0.928	FZD10_MOUSE Frizzled-10 OS=Mus musculus OX=10090 GN=Fzd10 PE=1 SV=1
4	Q8K4C8	0.0	764	592	0.640	0.628	FZD9_RAT Frizzled-9 OS=Rattus norvegicus OX=10116 GN=Fzd9 PE=2 SV=1
5	Q8TAN2	0.0	734	591	0.620	0.609	Q8TAN2_HUMAN Frizzled homolog 9 (Drosophila) OS=Homo sapiens OX=9606 GN=FZD9 PE=1 SV=1
6	Q9QZH0	0.0	550	538	0.475	0.513	FZD4_RAT Frizzled-4 OS=Rattus norvegicus OX=10116 GN=Fzd4 PE=2 SV=1
7	Q9R216	0.0	765	592	0.640	0.628	FZD9_MOUSE Frizzled-9 OS=Mus musculus OX=10090 GN=Fzd9 PE=2 SV=1
8	Q9ULV1	0.0	549	537	0.475	0.514	FZD4_HUMAN Frizzled-4 OS=Homo sapiens OX=9606 GN=FZD4 PE=1 SV=2
9	Q9ULW2	0.0	1213	581	1.000	1.000	FZD10_HUMAN Frizzled-10 OS=Homo sapiens OX=9606 GN=FZD10 PE=1 SV=1
10	Q9W6E3	0.0	904	580	0.752	0.753	Q9W6E3_DANRE Frizzled class receptor 10 OS=Danio rerio OX=7955 GN=fk48e04 PE=2 SV=1
11	Q9YI00	1.01e-170	498	579	0.427	0.428	Q9YI00_DANRE Frizzled 8a protein OS=Danio rerio OX=7955 GN=zg05 PE=2 SV=1
12	Q8AVJ9	1.84e-168	491	548	0.442	0.469	FZD7B_XENLA Frizzled-7-B OS=Xenopus laevis OX=8355 GN=fzd7-b PE=1 SV=1
13	Q9PUK8	2.22e-168	491	549	0.441	0.466	FZD7A_XENLA Frizzled-7-A OS=Xenopus laevis OX=8355 GN=fzd7-a PE=1 SV=2
14	Q9PWK6	1.65e-167	490	576	0.427	0.431	Q9PWK6_DANRE Frizzled 8b protein OS=Danio rerio OX=7955 GN=ZG06 PE=2 SV=1
15	Q6NV44	2.11e-167	489	559	0.432	0.449	Q6NV44_DANRE Frizzled class receptor 7a OS=Danio rerio OX=7955 GN=fzd7a PE=2 SV=2
16	Q90ZT3	5.92e-167	488	559	0.430	0.447	Q90ZT3_DANRE Frizzled 7b OS=Danio rerio OX=7955 GN=zg07 PE=2 SV=1
17	Q8QFM3	1.39e-165	484	557	0.435	0.454	Q8QFM3_DANRE Frizzled 7a OS=Danio rerio OX=7955 GN=fz7b PE=1 SV=1
18	O93274	3.26e-165	484	581	0.418	0.418	FZD8_XENLA Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 SV=1
19	B3DIG4	4.82e-165	484	592	0.423	0.416	B3DIG4_DANRE Frizzled class receptor 5 OS=Danio rerio OX=7955 GN=fzd8c PE=2 SV=1
20	Q9EQD0	1.17e-163	481	585	0.439	0.436	FZD5_MOUSE Frizzled-5 OS=Mus musculus OX=10090 GN=Fzd5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01534 Frizzled	2.7e-131	449.1	Frizzled/Smoothened family membrane region
2	PF01392 Fz	5.3e-29	112.5	Fz domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000229030

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000294304	0.969	Low-density lipoprotein receptor-related protein 5
2	9606.ENSP00000341032	0.959	Protein Wnt-7b
3	9606.ENSP00000293549	0.914	Proto-oncogene Wnt-1
4	9606.ENSP00000285018	0.899	Protein Wnt-7a
5	9606.ENSP00000261349	0.894	Low-density lipoprotein receptor-related protein 6
6	9606.ENSP00000222462	0.888	Protein Wnt-16
7	9606.ENSP00000257696	0.870	Hypoxia-inducible lipid droplet-associated protein
8	9606.ENSP00000264634	0.868	Protein Wnt-5a
9	9606.ENSP00000368169	0.866	Segment polarity protein dishevelled homolog DVL-1
10	9606.ENSP00000284523	0.855	Protein Wnt-3a
11	9606.ENSP00000290167	0.855	Protein Wnt-4
12	9606.ENSP00000358698	0.854	Protein Wnt-2b
13	9606.ENSP00000478721	0.852	Tyrosine-protein kinase RYK
14	9606.ENSP00000225512	0.851	Proto-oncogene Wnt-3
15	9606.ENSP00000316054	0.849	Segment polarity protein dishevelled homolog DVL-3
16	9606.ENSP00000325526	0.844	Protein Wnt-11
17	9606.ENSP00000290015	0.840	Protein Wnt-9b
18	9606.ENSP00000340677	0.834	Protein Wnt-8b
19	9606.ENSP00000272164	0.831	Protein Wnt-9a
20	9606.ENSP00000426653	0.831	Protein Wnt-8a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042813	1.000	Wnt receptor activity
GO:0017147	0.981	Wnt-protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007166	0.996	cell surface receptor signaling pathway
GO:0016055	0.989	Wnt signaling pathway
GO:0048518	0.969	positive regulation of biological process
GO:0048856	0.947	anatomical structure development
GO:0019222	0.879	regulation of metabolic process
GO:0048522	0.873	positive regulation of cellular process
GO:0060255	0.870	regulation of macromolecule metabolic process
GO:0032501	0.844	multicellular organismal process
GO:0060070	0.792	canonical Wnt signaling pathway
GO:0080090	0.777	regulation of primary metabolic process
GO:0051171	0.776	regulation of nitrogen compound metabolic process
GO:0031323	0.735	regulation of cellular metabolic process
GO:0048583	0.714	regulation of response to stimulus
GO:0048519	0.685	negative regulation of biological process
GO:0007275	0.662	multicellular organism development
GO:0010604	0.637	positive regulation of macromolecule metabolic process
GO:0009966	0.619	regulation of signal transduction
GO:0010468	0.608	regulation of gene expression
GO:0048731	0.556	system development
GO:0065009	0.538	regulation of molecular function
GO:0048523	0.503	negative regulation of cellular process
GO:0051252	0.496	regulation of RNA metabolic process
GO:0010556	0.493	regulation of macromolecule biosynthetic process
GO:0031326	0.484	regulation of cellular biosynthetic process
GO:0051173	0.475	positive regulation of nitrogen compound metabolic process
GO:0031325	0.469	positive regulation of cellular metabolic process
GO:0006355	0.463	regulation of DNA-templated transcription
GO:0048584	0.449	positive regulation of response to stimulus
GO:0009967	0.432	positive regulation of signal transduction
GO:0009653	0.418	anatomical structure morphogenesis
GO:0048513	0.344	animal organ development
GO:0009888	0.326	tissue development
GO:0051246	0.322	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.951	intracellular anatomical structure
GO:0043226	0.917	organelle
GO:0005737	0.908	cytoplasm
GO:0043227	0.883	membrane-bounded organelle
GO:0043229	0.807	intracellular organelle
GO:0043231	0.777	intracellular membrane-bounded organelle
GO:0070013	0.467	intracellular organelle lumen
GO:0005634	0.302	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]