StarFunc result for job id Q9ULX6

User Input

>input (646 residues)
MSYTGFVQGSETTLQSTYSDTSAQPTCDYGYGTWNSGTNRGYEGYGYGYGYGQDNTTNYG
YGMATSHSWEMPSSDTNANTSASGSASADSVLSRINQRLDMVPHLETDMMQGGVYGSGGE
RYDSYESCDSRAVLSERDLYRSGYDYSELDPEMEMAYEGQYDAYRDQFRMRGNDTFGPRA
QGWARDARSGRPMASGYGRMWEDPMGARGQCMSGASRLPSLFSQNIIPEYGMFQGMRGGG
AFPGGSRFGFGFGNGMKQMRRTWKTWTTADFRTKKKKRKQGGSPDEPDSKATRTDCSDNS
DSDNDEGTEGEATEGLEGTEAVEKGSRVDGEDEEGKEDGREEGKEDPEKGALTTQDENGQ
TKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYV
GTKLPKQTADFLQEYVTNKTKKTEELRKTVEDLDGLIQQIYRDQDLTQEIAMEHFVKKVE
AAHCAACDLFIPMQFGIIQKHLKTMDHNRNRRLMMEQSKKSSLMVARSILNNKLISKKLE
RYLKGENPFTDSPEEEKEQEEAEGGALDEGAQGEAAGISEGAEGVPAQPPVPPEPAPGAV
SPPPPPPPEEEEEGAVPLLGGALQRQIRGIPGLDVEDDEEGGGGAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULX6	0.999	0.999	3.308E-87	646	1.000	1.000	Q9ULX6.pdb.gz	AKP8L_HUMAN A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L PE=1 SV=4
2	AFDB:Q5VK71	0.273	0.257	1.652E-27	698	0.324	0.299	Q5VK71.pdb.gz	AKAP8_CANLF A-kinase anchor protein 8 OS=Canis lupus familiaris OX=9615 GN=AKAP8 PE=1 SV=1
3	AFDB:O43823	0.277	0.260	3.090E-27	692	0.322	0.301	O43823.pdb.gz	AKAP8_HUMAN A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1
4	AFDB:Q63014	0.265	0.251	5.156E-27	687	0.311	0.293	Q63014.pdb.gz	AKAP8_RAT A-kinase anchor protein 8 OS=Rattus norvegicus OX=10116 GN=Akap8 PE=1 SV=1
5	AFDB:Q9VMA7	0.070	0.040	2.961E-2	1430	0.142	0.064	Q9VMA7.pdb.gz	TGO1_DROME Transport and Golgi organization protein 1 OS=Drosophila melanogaster OX=7227 GN=Tango1 PE=1 SV=2
6	AFDB:A0A1D8PFD3	0.055	0.038	3.317E-2	1001	0.173	0.112	A0A1D8PFD3.pdb.gz	A0A1D8PFD3_CANAL Snt1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNT1 PE=4 SV=1
7	AFDB:O43019	0.079	0.068	1.160E-1	793	0.139	0.113	O43019.pdb.gz	SRE2_SCHPO Putative transcription factor sre2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sre2 PE=1 SV=1
8	AFDB:Q9VED3	0.077	0.046	1.228E-1	1186	0.108	0.059	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
9	AFDB:Q9SU08	0.067	0.052	1.828E-1	904	0.138	0.098	Q9SU08.pdb.gz	AUXI1_ARATH Auxilin-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=AUXI1 PE=1 SV=2
10	AFDB:Q9VUQ9	0.071	0.031	1.828E-1	2139	0.163	0.049	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
11	PDB:6qx91C	0.055	0.565	1.085	50	0.014	0.180	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:7v3vI	0.053	0.093	1.710	328	0.009	0.018	7v3vI.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
13	PDB:5o9zQ	0.074	0.413	3.583	75	0.017	0.147	5o9zQ.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
14	PDB:7wkwB	0.050	0.069	4.250	377	0.014	0.024	7wkwB.pdb.gz	Structures and mechanisms of the Arabidopsis auxin transporter PIN3.
15	PDB:6hivA5	0.033	0.247	5.041	55	0.014	0.164	6hivA5.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
16	PDB:6lqsr6	0.038	0.182	5.041	104	0.009	0.058	6lqsr6.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
17	PDB:7ungB0	0.076	0.187	5.041	193	0.039	0.130	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
18	PDB:6t9lN	0.042	0.266	7.507	82	0.011	0.085	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.
19	PDB:7pmkR	0.052	0.057	7.507	552	0.020	0.024	7pmkR.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
20	PDB:6n7rI	0.066	0.219	8.412	147	0.012	0.054	6n7rI.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9R0L7	0.0	1040	642	0.920	0.925	AKP8L_MOUSE A-kinase anchor protein 8-like OS=Mus musculus OX=10090 GN=Akap8l PE=1 SV=1
2	Q9ULX6	0.0	1337	646	1.000	1.000	AKP8L_HUMAN A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L PE=1 SV=4
3	Q5VK71	3.28e-73	251	698	0.320	0.297	AKAP8_CANLF A-kinase anchor protein 8 OS=Canis lupus familiaris OX=9615 GN=AKAP8 PE=1 SV=1
4	O43823	8.88e-71	244	692	0.310	0.289	AKAP8_HUMAN A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1
5	Q9DBR0	8.54e-68	236	687	0.300	0.282	AKAP8_MOUSE A-kinase anchor protein 8 OS=Mus musculus OX=10090 GN=Akap8 PE=1 SV=1
6	Q63014	2.73e-66	232	687	0.283	0.266	AKAP8_RAT A-kinase anchor protein 8 OS=Rattus norvegicus OX=10116 GN=Akap8 PE=1 SV=1
7	Q5BKZ1	4.17e-32	133	582	0.094	0.105	ZN326_HUMAN DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=2
8	A0A0A0MRN4	1.19e-31	131	493	0.094	0.124	A0A0A0MRN4_HUMAN Zinc finger protein 326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=1
9	O88291	7.38e-30	127	580	0.096	0.107	ZN326_MOUSE DBIRD complex subunit ZNF326 OS=Mus musculus OX=10090 GN=Znf326 PE=1 SV=1
10	A8J666	1.2	35.0	3081	0.023	0.005	CFA54_CHLRE Cilia- and flagella-associated protein 54 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP54 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04988 AKAP95	1.4e-54	195.5	A-kinase anchoring protein 95 (AKAP95)
2	PF05605 zf-Di19	9.3e+02	11.6	Drought induced 19 protein (Di19), zinc-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380557

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356520	0.931	ATP-dependent RNA helicase A
2	9606.ENSP00000463069	0.917	E3 ubiquitin-protein ligase RNF43
3	9606.ENSP00000386458	0.874	Pre-mRNA-processing factor 40 homolog A
4	9606.ENSP00000316042	0.697	Heterogeneous nuclear ribonucleoprotein A0
5	9606.ENSP00000339883	0.694	Lamin-B receptor
6	9606.ENSP00000347184	0.684	Huntingtin
7	9606.ENSP00000266732	0.680	Lamina-associated polypeptide 2, isoform alpha
8	9606.ENSP00000256103	0.677	Myelin P2 protein
9	9606.ENSP00000306920	0.674	Beta-galactosidase
10	9606.ENSP00000349748	0.626	Splicing factor, proline- and glutamine-rich
11	9606.ENSP00000267294	0.621	Zinc finger protein ZIC 5
12	9606.ENSP00000446955	0.579	Myosin light polypeptide 6
13	9606.ENSP00000358857	0.565	Emerin
14	9606.ENSP00000436679	0.553	Nuclear RNA export factor 1
15	9606.ENSP00000276079	0.548	Non-POU domain-containing octamer-binding protein
16	9606.ENSP00000274364	0.547	Ras GTPase-activating-like protein IQGAP2
17	9606.ENSP00000316809	0.513	Phosphatidylinositol transfer protein alpha isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005521	1.000	lamin binding
GO:0042826	1.000	histone deacetylase binding
GO:0017151	1.000	DEAD/H-box RNA helicase binding
GO:0003723	1.000	RNA binding
GO:0003677	0.346	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050789	0.994	regulation of biological process
GO:0048518	0.984	positive regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0006996	0.958	organelle organization
GO:0010468	0.954	regulation of gene expression
GO:0071704	0.945	organic substance metabolic process
GO:0019219	0.945	regulation of nucleobase-containing compound metabolic process
GO:0044238	0.933	primary metabolic process
GO:0044237	0.932	cellular metabolic process
GO:0006807	0.930	nitrogen compound metabolic process
GO:0043170	0.929	macromolecule metabolic process
GO:0000278	0.929	mitotic cell cycle
GO:0048522	0.928	positive regulation of cellular process
GO:0009893	0.920	positive regulation of metabolic process
GO:0051252	0.831	regulation of RNA metabolic process
GO:0010556	0.792	regulation of macromolecule biosynthetic process
GO:0010604	0.792	positive regulation of macromolecule metabolic process
GO:0031326	0.791	regulation of cellular biosynthetic process
GO:1901360	0.761	organic cyclic compound metabolic process
GO:0010467	0.726	gene expression
GO:0051173	0.723	positive regulation of nitrogen compound metabolic process
GO:0031325	0.695	positive regulation of cellular metabolic process
GO:0090304	0.694	nucleic acid metabolic process
GO:0006355	0.682	regulation of DNA-templated transcription
GO:0051246	0.545	regulation of protein metabolic process
GO:0006997	0.519	nucleus organization
GO:0016070	0.495	RNA metabolic process
GO:0006396	0.494	RNA processing
GO:0010557	0.476	positive regulation of macromolecule biosynthetic process
GO:0051254	0.476	positive regulation of RNA metabolic process
GO:0031328	0.471	positive regulation of cellular biosynthetic process
GO:0022402	0.466	cell cycle process
GO:0045893	0.438	positive regulation of DNA-templated transcription
GO:0031399	0.432	regulation of protein modification process
GO:0051247	0.424	positive regulation of protein metabolic process
GO:0010256	0.401	endomembrane system organization
GO:0060341	0.395	regulation of cellular localization
GO:0006397	0.391	mRNA processing
GO:0051049	0.385	regulation of transport
GO:0031401	0.367	positive regulation of protein modification process
GO:0032386	0.338	regulation of intracellular transport
GO:0000280	0.329	nuclear division
GO:1903047	0.316	mitotic cell cycle process
GO:0006357	0.310	regulation of transcription by RNA polymerase II
GO:0061024	0.303	membrane organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016363	0.999	nuclear matrix
GO:0005654	0.995	nucleoplasm
GO:0043232	0.963	intracellular non-membrane-bounded organelle
GO:0005737	0.883	cytoplasm
GO:0032991	0.860	protein-containing complex
GO:0016604	0.785	nuclear body
GO:0016020	0.771	membrane
GO:0005694	0.670	chromosome
GO:0000785	0.654	chromatin
GO:1990904	0.632	ribonucleoprotein complex
GO:0016607	0.629	nuclear speck
GO:0005829	0.562	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]