StarFunc result for job id Q9ULX9

User Input

>input (164 residues)
MSVDPLSSKALKIKRELSENTPHLSDEALMGLSVRELNRHLRGLSAEEVTRLKQRRRTLK
NRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQGFARS
VAAARGPATLVAPASVITIVKSTPGSGSGPAHGPDPAHGPASCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULX9	1.000	1.000	2.874E-23	164	1.000	1.000	Q9ULX9.pdb.gz	MAFF_HUMAN Transcription factor MafF OS=Homo sapiens OX=9606 GN=MAFF PE=1 SV=2
2	AFDB:A0A024R804	0.633	0.665	2.002E-12	156	0.622	0.654	A0A024R804.pdb.gz
3	AFDB:A0A0R4IVU1	0.648	0.677	3.449E-12	157	0.628	0.656	A0A0R4IVU1.pdb.gz	A0A0R4IVU1_DANRE Transcription factor MafK isoform X1 OS=Danio rerio OX=7955 GN=mafk PE=4 SV=1
4	AFDB:Q6NW89	0.628	0.603	3.952E-12	171	0.561	0.538	Q6NW89.pdb.gz	Q6NW89_DANRE Transcription factor mafG2 OS=Danio rerio OX=7955 GN=mafg2 PE=2 SV=1
5	AFDB:Q76MX4	0.632	0.550	1.649E-11	189	0.598	0.519	Q76MX4.pdb.gz	MAFG_RAT Transcription factor MafG OS=Rattus norvegicus OX=10116 GN=Mafg PE=2 SV=2
6	AFDB:Q7T3H0	0.648	0.672	2.341E-10	158	0.567	0.589	Q7T3H0.pdb.gz	Q7T3H0_DANRE Transcription factor MafF OS=Danio rerio OX=7955 GN=maft PE=2 SV=1
7	AFDB:B3DGW9	0.587	0.314	8.707E-8	318	0.348	0.179	B3DGW9.pdb.gz
8	AFDB:F6WVZ0	0.605	0.616	1.068E-7	161	0.378	0.385	F6WVZ0.pdb.gz	F6WVZ0_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 GN=LOC778757 PE=1 SV=1
9	AFDB:D3ZNT6	0.439	0.221	4.456E-7	361	0.329	0.150	D3ZNT6.pdb.gz	MAFA_RAT Transcription factor MafA OS=Rattus norvegicus OX=10116 GN=Mafa PE=1 SV=1
10	AFDB:Q98UK5	0.578	0.274	5.850E-7	356	0.341	0.157	Q98UK5.pdb.gz	MAFB_DANRE Transcription factor MafB OS=Danio rerio OX=7955 GN=mafb PE=2 SV=1
11	PDB:7nvmP	0.195	0.172	1.655	190	0.067	0.058	7nvmP.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
12	PDB:6yxxBS	0.281	0.285	1.772	161	0.140	0.143	6yxxBS.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
13	PDB:6so5C	0.210	0.234	1.897	144	0.049	0.056	6so5C.pdb.gz	Structural Basis of Tail-Anchored Membrane Protein Biogenesis by the GET Insertase Complex.
14	PDB:3lssA	0.167	0.070	2.173	438	0.061	0.023	3lssA.pdb.gz	X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
15	PDB:4i9qB	0.188	0.041	2.326	873	0.061	0.011	4i9qB.pdb.gz	A Remote Palm Domain Residue of RB69 DNA Polymerase Is Critical for Enzyme Activity and Influences the Conformation of the Active Site.
16	PDB:5ng5A	0.229	0.118	2.326	340	0.073	0.035	5ng5A.pdb.gz	An allosteric transport mechanism for the AcrAB-TolC Multidrug Efflux Pump.
17	PDB:5svaU	0.268	0.280	2.326	156	0.098	0.103	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
18	PDB:7v2wI	0.262	0.193	2.490	240	0.134	0.092	7v2wI.pdb.gz
19	PDB:7rdqD	0.155	0.023	2.665	1366	0.049	0.006	7rdqD.pdb.gz	Structural and mechanistic basis of reiterative transcription initiation.
20	PDB:7wooE	0.121	0.022	2.853	1552	0.079	0.008	7wooE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ULX9	1.28e-116	328	164	1.000	1.000	MAFF_HUMAN Transcription factor MafF OS=Homo sapiens OX=9606 GN=MAFF PE=1 SV=2
2	O54791	6.13e-95	273	156	0.841	0.885	MAFF_MOUSE Transcription factor MafF OS=Mus musculus OX=10090 GN=Maff PE=2 SV=1
3	B0QY70	5.34e-85	247	125	0.762	1.000	B0QY70_HUMAN MAF bZIP transcription factor F (Fragment) OS=Homo sapiens OX=9606 GN=MAFF PE=1 SV=8
4	O60675	3.34e-65	198	156	0.622	0.654	MAFK_HUMAN Transcription factor MafK OS=Homo sapiens OX=9606 GN=MAFK PE=1 SV=1
5	Q61827	5.65e-65	197	156	0.622	0.654	MAFK_MOUSE Transcription factor MafK OS=Mus musculus OX=10090 GN=Mafk PE=1 SV=1
6	Q6IRI7	1.82e-64	196	156	0.616	0.647	Q6IRI7_RAT V-maf musculoaponeurotic fibrosarcoma oncogene homolog K (Avian) OS=Rattus norvegicus OX=10116 GN=Mafk PE=1 SV=1
7	Q4V999	6.28e-64	194	154	0.634	0.675	Q4V999_DANRE Transcription factor MafK OS=Danio rerio OX=7955 GN=mafk PE=2 SV=1
8	A0A0R4IVU1	3.03e-63	193	157	0.628	0.656	A0A0R4IVU1_DANRE Transcription factor MafK isoform X1 OS=Danio rerio OX=7955 GN=mafk PE=4 SV=1
9	Q6I6N2	1.96e-58	181	162	0.591	0.599	Q6I6N2_DANRE Transcription factor MafG OS=Danio rerio OX=7955 GN=mafg1 PE=2 SV=1
10	O15525	2.94e-58	181	162	0.610	0.617	MAFG_HUMAN Transcription factor MafG OS=Homo sapiens OX=9606 GN=MAFG PE=1 SV=1
11	O54790	3.24e-58	181	162	0.610	0.617	MAFG_MOUSE Transcription factor MafG OS=Mus musculus OX=10090 GN=Mafg PE=1 SV=1
12	Q6NW89	1.70e-55	174	171	0.585	0.561	Q6NW89_DANRE Transcription factor mafG2 OS=Danio rerio OX=7955 GN=mafg2 PE=2 SV=1
13	Q76MX4	1.79e-55	174	189	0.585	0.508	MAFG_RAT Transcription factor MafG OS=Rattus norvegicus OX=10116 GN=Mafg PE=2 SV=2
14	Q7T3H0	2.01e-52	166	158	0.573	0.595	Q7T3H0_DANRE Transcription factor MafF OS=Danio rerio OX=7955 GN=maft PE=2 SV=1
15	F6WVZ0	1.15e-37	128	161	0.378	0.385	F6WVZ0_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 GN=LOC778757 PE=1 SV=1
16	Q9Y5Q3	2.54e-28	108	323	0.329	0.167	MAFB_HUMAN Transcription factor MafB OS=Homo sapiens OX=9606 GN=MAFB PE=1 SV=2
17	P54841	2.82e-28	108	323	0.329	0.167	MAFB_MOUSE Transcription factor MafB OS=Mus musculus OX=10090 GN=Mafb PE=1 SV=1
18	P54842	3.10e-28	108	323	0.329	0.167	MAFB_RAT Transcription factor MafB OS=Rattus norvegicus OX=10116 GN=Mafb PE=1 SV=1
19	Q98UK5	2.85e-27	106	356	0.317	0.146	MAFB_DANRE Transcription factor MafB OS=Danio rerio OX=7955 GN=mafb PE=2 SV=1
20	Q4QPP9	6.71e-27	100	132	0.305	0.379	Q4QPP9_DROME GH02096p OS=Drosophila melanogaster OX=7227 GN=maf-S PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	0.61	21.5	bZIP transcription factor
2	PF07716 bZIP_2	19	16.7	Basic region leucine zipper
3	PF03131 bZIP_Maf	3.5e-30	115.7	bZIP Maf transcription factor
4	PF04977 DivIC	15	16.8	Septum formation initiator
5	PF06698 DUF1192	2.4e+02	13.2	Protein of unknown function (DUF1192)
6	PF09755 DUF2046	13	16.4	Uncharacterized conserved protein H4 (DUF2046)
7	PF19717 DUF6212	59	14.1	Family of unknown function (DUF6212)
8	PF18210 Knl1_RWD_C	6.4e+02	12.0	Knl1 RWD C-terminal domain
9	PF09726 Macoilin	3.4e+02	11.2	Macoilin family
10	PF13874 Nup54	2e+02	13.5	Nucleoporin complex subunit 54

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345393

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380252	0.995	Nuclear factor erythroid 2-related factor 2
2	9606.ENSP00000439120	0.933	Transcription factor NF-E2 45 kDa subunit
3	9606.ENSP00000350369	0.932	Transcription factor MafG
4	9606.ENSP00000354855	0.913	Nuclear factor erythroid 2-related factor 1
5	9606.ENSP00000344903	0.910	Transcription factor MafK
6	9606.ENSP00000369586	0.909	Hemoglobin subunit epsilon
7	9606.ENSP00000257749	0.907	Transcription regulator protein BACH2
8	9606.ENSP00000327431	0.903	Hemoglobin subunit gamma 1
9	9606.ENSP00000369609	0.903	Hemoglobin subunit gamma-2
10	9606.ENSP00000333994	0.900	Hemoglobin subunit beta
11	9606.ENSP00000369654	0.900	Hemoglobin subunit delta
12	9606.ENSP00000056233	0.870	Nuclear factor erythroid 2-related factor 3
13	9606.ENSP00000382805	0.807	Transcription regulator protein BACH1
14	9606.ENSP00000344352	0.733	Cyclic AMP-dependent transcription factor ATF-3
15	9606.ENSP00000438468	0.726	Protein-cysteine N-palmitoyltransferase HHAT
16	9606.ENSP00000324270	0.643	Oxytocin receptor
17	9606.ENSP00000306245	0.577	Proto-oncogene c-Fos
18	9606.ENSP00000171111	0.569	Kelch-like ECH-associated protein 1
19	9606.ENSP00000360266	0.544	Transcription factor AP-1
20	9606.ENSP00000305941	0.520	Usherin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0001067	0.712	transcription regulatory region nucleic acid binding
GO:0000976	0.704	transcription cis-regulatory region binding
GO:0042802	0.430	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0006355	0.987	regulation of DNA-templated transcription
GO:0048522	0.986	positive regulation of cellular process
GO:0009893	0.979	positive regulation of metabolic process
GO:0045935	0.962	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.959	positive regulation of macromolecule biosynthetic process
GO:0031328	0.958	positive regulation of cellular biosynthetic process
GO:0045893	0.950	positive regulation of DNA-templated transcription
GO:0032501	0.877	multicellular organismal process
GO:0009987	0.811	cellular process
GO:0044706	0.595	multi-multicellular organism process
GO:0006357	0.522	regulation of transcription by RNA polymerase II
GO:0044703	0.464	multi-organism reproductive process
GO:0045944	0.402	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.983	protein-containing complex
GO:0005737	0.934	cytoplasm
GO:0090575	0.886	RNA polymerase II transcription regulator complex
GO:0005829	0.530	cytosol
GO:0005739	0.303	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]